Details for Chinese cabbage Locus Brara.E03093

Position : A05 ( 5`- 25554484 .. 25557024 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03093

Protein [Map View]
MSCNFNPSSSSSRDEEVKKMEEEDECVENKQSTAASCSSVSEGSGGGGGSSFLKSSPAVASPPTVSPTHRRTSGPIRRAK
GGWTTEEDETLRQAVCTYNAKSWKKIAEFFPDRTEVQCLHRWQKVLNPDLIKGPWTQEEDEKIVELVKKYGPAKWSTIAK
SLEGRIGKQCRERWHNHLNPGINKEAWTPEEEVALMNAHRVHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKSEFYQANG
ALPPSAAKNGVLDSATKRPLFYQRRDSAIQINKPDEDGKHQLKSSVPLEEVVAASPLTSDQLPRPEPSPENGYHLYYKNP
QTEYSMASEADKQRMYGYECGCSPSASPVIFFTPPPPSRKEYFNGLRPTSPESYLREAARTFPNTPSIFRKRRRRTVVVS
DSDNKAAKTDEEGTKEAVVVVDQKVNEISESPDIEEKESNDGSNAYNLSPPYRIRSKRTAVFKSRQLEFISPEEAKADDD
DETKSSEKDKVLDGGDSQLPV*

DNA
ATGAGCTGCAATTTCAATCCATCGTCTTCTTCCTCCCGAGATGAGGAAGTGAAGAAGATGGAGGAGGAGGATGAGTGTGT
AGAGAATAAGCAATCAACAGCTGCTTCTTGCTCCTCTGTATCTGAAGGCAGTGGTGGTGGTGGTGGTAGTAGTTTCCTCA
AGTCGTCTCCTGCTGTTGCAAGTCCTCCCACTGTCTCTCCAACTCATAGGAGGACGAGTGGCCCTATAAGGCGAGCCAAG
GGCGGTTGGACTACTGAAGAGGATGAGACATTGAGACAAGCAGTTTGTACGTATAATGCCAAGAGCTGGAAGAAAATAGC
GGAGTTTTTCCCTGATAGAACCGAAGTTCAATGCCTGCACCGATGGCAGAAAGTTTTGAATCCTGACCTTATTAAAGGAC
CATGGACGCAAGAGGAGGATGAGAAGATCGTTGAACTTGTTAAAAAATACGGTCCTGCGAAATGGTCTACTATCGCCAAG
TCTTTAGAAGGTAGAATTGGGAAGCAATGTCGAGAAAGGTGGCACAACCATTTGAACCCTGGTATCAACAAGGAGGCTTG
GACCCCAGAGGAAGAGGTAGCTCTCATGAATGCTCATCGAGTCCATGGAAACAAATGGGCTGAAATCGCTAAGGTCTTAC
CCGGCAGAACCGATAATTCGATAAAGAATCATTGGAACAGTTCATTGAAGAAGAAGTCAGAGTTCTACCAAGCTAACGGC
GCCTTACCACCTTCAGCAGCAAAGAACGGTGTTCTTGATAGTGCTACTAAACGTCCATTGTTTTATCAGAGAAGGGATTC
TGCTATACAGATAAACAAACCAGATGAAGACGGAAAACACCAGCTAAAATCTTCTGTTCCGCTAGAAGAAGTAGTAGCTG
CTTCACCACTGACCAGTGATCAGTTACCTAGGCCTGAGCCATCGCCGGAGAATGGTTACCATCTTTACTACAAGAACCCT
CAAACAGAGTATTCCATGGCGTCTGAAGCGGATAAGCAGCGTATGTACGGGTATGAATGCGGCTGCAGTCCGAGCGCATC
GCCTGTTATCTTCTTCACTCCACCGCCTCCTAGTAGAAAAGAGTACTTTAACGGTTTGCGTCCAACAAGTCCTGAATCTT
ACCTGAGAGAAGCTGCTAGAACTTTCCCAAACACGCCTTCCATTTTCAGGAAAAGACGGCGCAGGACTGTTGTTGTTTCT
GATAGCGACAACAAGGCCGCGAAAACAGATGAAGAAGGTACTAAAGAGGCTGTTGTTGTTGTTGATCAGAAGGTGAATGA
GATCTCAGAGAGCCCTGATATTGAAGAGAAGGAGAGCAATGATGGATCAAACGCTTACAACTTGTCTCCTCCGTACCGGA
TAAGATCCAAAAGAACAGCTGTTTTCAAGTCAAGACAGCTTGAGTTCATCTCTCCAGAGGAAGCAAAAGCAGATGATGAT
GATGAAACCAAATCATCTGAGAAAGATAAGGTGCTTGATGGGGGAGACTCTCAACTCCCAGTCTAA