Details for Chinese cabbage Locus Brara.E03091

Position : A05 ( 5`- 25545710 .. 25546404 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03091

Protein [Map View]
MSCCGGNCGCGSGCKCGNGCGGCKMYPDLGFSGESTTTETFVFGVAPAMKNQYEASGEGVAENDACKCGSDCKCDPCTCK
*

DNA
ATGTCTTGCTGTGGTGGAAACTGTGGTTGTGGATCTGGCTGCAAGTGCGGCAACGGTTGCGGAGGTTGCAAAATGTACCC
GGACTTGGGCTTTTCCGGCGAGTCGACCACGACCGAGACTTTTGTCTTCGGCGTTGCACCGGCGATGAAGAACCAGTACG
AGGCTTCTGGAGAGGGTGTCGCTGAGAACGATGCATGCAAGTGTGGATCTGACTGCAAGTGTGATCCTTGCACCTGTAAA
TGA