Details for Chinese cabbage Locus Brara.E03090

Position : A05 ( 5`- 25537628 .. 25540298 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03090

Protein [Map View]
MGNGASGCCVAGDTSRRCGVERFHDNLGHSFSYVRPVLDGSRPSFTREPSLQPDPIPGTTTTFRSISGASVSANNSTSLS
DSLSTDLSLKASGFESSNKFASFPLKPVPRGPTKKPSHVSGPFERRFLSGPIETGLVKKKKKTKSFSKPKPNKRLATFKT
IFTNLISNNQSRSKKGLIEPINSFNSSTSDHHRPEINNSSTSTTLSSQESPRTKEREDSEEEEEEGKSECSLEEPKIQWA
EGKAGEDRVHVILSEENGWLFVGIYDGFNGPDPPDYLLNNLYTAVLKELKGLLWDDENNSDDIASCSEDGQSQIKKQSST
LEGGTVACDTRNIVACDSRNIAEDVKKLQWRYASKQNYIESDSEMINHKDVLKALEQALMKTEEAFDQTVDENPVLALMG
SCVLVTLMKGEDVYVMSVGDSRAVLAQRSYLGRKKVANDLQRIKEEGGPLKTCLVREKRVSLLVPVQLTMEHSTNVQEEV
RRIRNEHSDDPLAIENGRVKGYLKVTRAFGAGFLKQPKWNKAVLEMFRINYVGTSPYITCSPSLHHHRLTPHDKFLILSS
DGLYEYFSSEEVIFEVESFISAFPEGDPAQHLIQEVLLRAAKKYGMDFHELLEIAQGDRRKYHDDVSAIVISLEGRIWKS
SM*

DNA
ATGGGAAACGGAGCCAGTGGCTGTTGCGTGGCCGGAGACACTTCCAGACGATGCGGTGTCGAACGCTTTCACGACAACCT
CGGTCACTCTTTCAGCTATGTCCGGCCAGTCCTCGACGGATCAAGACCTTCTTTCACGCGGGAACCGTCTCTCCAACCCG
ACCCGATCCCTGGAACTACGACCACTTTCCGTTCAATCTCCGGCGCTTCCGTTAGCGCCAATAACTCAACGTCGCTCTCT
GACTCTCTCTCAACGGACTTGTCGTTAAAGGCCTCCGGGTTCGAGAGCTCTAACAAGTTCGCTTCCTTTCCCCTCAAGCC
CGTGCCGCGTGGTCCGACGAAGAAGCCGAGTCACGTGTCCGGTCCGTTCGAGCGACGGTTTTTATCCGGTCCGATCGAAA
CCGGTTTGGTTAAGAAGAAAAAGAAGACCAAATCATTTTCTAAACCTAAACCGAACAAGAGACTTGCCACGTTTAAAACC
ATTTTCACAAACTTGATATCTAACAATCAATCTCGCTCGAAGAAGGGCTTGATCGAGCCAATCAATAGTTTCAATTCATC
AACTTCGGATCATCATAGACCTGAGATCAATAACTCAAGCACAAGCACGACTCTGAGCAGCCAAGAGAGCCCTAGAACCA
AAGAAAGAGAAGACTCTGAAGAAGAAGAAGAAGAGGGGAAGAGTGAGTGTTCTCTAGAGGAGCCAAAGATTCAATGGGCG
GAGGGTAAAGCAGGGGAAGACAGAGTACACGTCATCCTCTCTGAGGAAAACGGTTGGCTTTTCGTGGGGATTTACGACGG
ATTCAACGGTCCAGATCCACCGGATTATCTTCTCAACAATCTCTACACCGCCGTGCTCAAAGAGCTCAAAGGGTTGCTAT
GGGACGACGAAAACAACTCCGATGATATTGCATCATGTAGCGAAGACGGTCAGTCCCAGATCAAGAAACAGAGTAGTACA
CTGGAAGGAGGCACTGTTGCTTGTGACACAAGAAACATAGTTGCTTGTGACTCAAGAAACATAGCTGAGGATGTGAAGAA
GCTGCAATGGAGATACGCTTCGAAACAGAATTATATAGAATCTGACTCGGAGATGATTAACCACAAAGACGTGCTGAAAG
CACTTGAACAAGCGTTGATGAAAACGGAGGAAGCGTTTGATCAAACGGTGGATGAGAATCCAGTGTTAGCCTTGATGGGG
TCCTGCGTACTTGTGACACTAATGAAAGGTGAAGACGTTTACGTGATGAGCGTCGGAGATAGCCGAGCGGTTTTGGCGCA
AAGATCGTATCTCGGGAGGAAGAAGGTGGCGAATGATCTTCAGAGAATCAAGGAAGAGGGTGGTCCGTTAAAGACTTGTT
TGGTCAGAGAAAAAAGAGTCAGTCTTCTGGTTCCTGTTCAGCTCACTATGGAACACAGCACAAACGTTCAAGAGGAAGTG
AGAAGAATCAGGAATGAACATTCTGATGATCCATTGGCGATAGAGAATGGTAGAGTGAAAGGTTACCTCAAGGTCACTCG
TGCATTTGGCGCTGGATTTCTCAAACAACCGAAGTGGAACAAGGCGGTTCTAGAGATGTTCAGAATAAACTACGTTGGAA
CATCGCCGTACATCACGTGCTCCCCGTCGCTTCACCACCACAGACTCACGCCGCATGATAAGTTCCTTATCCTCTCTTCT
GATGGATTGTATGAATACTTCTCCAGTGAGGAAGTCATCTTCGAGGTTGAGTCTTTCATCTCAGCCTTCCCCGAAGGCGA
TCCTGCTCAGCATCTCATCCAAGAAGTCCTCCTTCGAGCTGCCAAAAAATATGGTATGGATTTCCACGAATTGTTGGAGA
TAGCTCAAGGAGATCGTCGCAAGTATCATGACGATGTTTCTGCGATTGTGATTTCACTTGAAGGAAGAATTTGGAAATCT
TCCATGTGA