Details for Chinese cabbage Locus Brara.E03083

Position : A05 ( 5`- 25513113 .. 25515497 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03083

Protein [Map View]
MGNLHGLHRSHHHNSPFPPSPAPPSSTSPYVPHMTMEPYCHVDSSLRSLAGKAEGFGRAAVGGLNGPVCHVTSLADEGPG
SLREACKRPEPLWIVFDVSGTIHLSSFVNVSSHKTVDGRGQRVKITGKGLRLKQSENVIICNLEFEGGVGPDADAIQIKP
KSSIIWIDRCTLKNYYDGLIDITRESTDITVSRCHFVNHNKTMLIGADPSHVTDRCIRVTIHHCFFDGTRQRHPRVRFAK
IHLFNNYTRNWSIYAVGAGVEAQVYSQCNIYEAGEKKTVFKYITEKAADKEEAEAGFIRSEGDWFLNGAKSCLSHEKEHR
VFSPTQHYSGWTVESSTEKLKKYIKHSTGWQNLPLPSDQLPTTA*

DNA
ATGGGAAACTTACATGGTCTTCACAGATCCCATCACCACAACTCCCCTTTCCCACCCTCTCCAGCTCCTCCATCTTCAAC
GTCTCCATACGTTCCCCACATGACGATGGAACCTTATTGCCACGTAGACTCAAGCCTCCGCTCCCTCGCCGGAAAGGCCG
AAGGTTTCGGCCGCGCTGCCGTTGGTGGTCTTAATGGTCCAGTTTGCCACGTCACTTCTTTAGCTGACGAAGGTCCAGGA
TCGTTACGAGAGGCTTGTAAGAGGCCAGAACCGTTATGGATTGTGTTTGATGTGTCTGGAACGATCCATTTATCTTCGTT
TGTGAACGTATCATCCCACAAAACGGTGGACGGAAGAGGGCAACGGGTGAAGATAACAGGGAAAGGGTTAAGGCTTAAAC
AAAGTGAAAACGTTATAATATGTAACCTTGAATTCGAAGGGGGTGTAGGACCAGACGCAGACGCTATTCAGATCAAACCA
AAATCAAGCATCATTTGGATTGATCGGTGTACTCTCAAGAATTACTATGATGGTTTGATTGATATCACACGAGAAAGCAC
TGACATTACTGTCTCAAGATGTCATTTCGTGAACCACAACAAGACAATGTTGATCGGCGCGGACCCAAGTCACGTGACGG
ACCGATGCATAAGAGTTACGATTCACCACTGCTTCTTCGACGGTACACGTCAGCGACACCCTCGTGTTCGCTTCGCAAAA
ATCCATCTCTTCAACAACTACACTCGTAACTGGTCCATCTATGCTGTCGGAGCCGGCGTCGAAGCTCAGGTCTATTCCCA
GTGCAACATATATGAAGCTGGTGAGAAGAAGACTGTGTTTAAGTACATCACTGAGAAGGCTGCGGATAAAGAGGAAGCCG
AAGCTGGTTTTATAAGATCAGAAGGGGATTGGTTCTTGAACGGCGCCAAGTCGTGTCTTAGCCACGAAAAAGAGCACCGC
GTGTTCTCTCCGACTCAACACTATTCTGGATGGACCGTCGAGTCTTCAACAGAGAAACTCAAGAAATATATTAAACACTC
GACCGGCTGGCAGAACCTTCCGCTTCCATCTGACCAACTCCCAACCACAGCATAA