Details for Chinese cabbage Locus Brara.E03082

Position : A05 ( 5`- 25506817 .. 25511320 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03082

Protein [Map View]
MSLVGRFGSLISQGVYSVATPFHPFGGAIDVIVVQQEDGSFRSTPWYVRFGKFQGVLKGAEKFVKISVNGTEADFHMYLD
NSGEAYFIREVDPTAANDNTENNNGNENNGLRLEHSLSDAGAEREGFNSLSRLDRTESDCNRRYYDFQDDDDDDDPPSPT
SEYGEGQGSDSEVVLVSVDGRILTAPVSAAEQEAENLRLNTPQFHLAPGDGTEFCEGNTEFASSETSWDAEFISKVESSE
KVDSRSRDITVKDSHYTELSQPVDNAKSEEPASTFEAQNLKEGELLLTTITEDVRGEDEVALVDGSESSTTQLTTEEVRI
TEESRISIDANTESECEDDHTKTSAETSILIESEASERVSIDSTREEDEQLTPSKPTEEDNENRNTMDSVAATSSVDIEL
KYELSLCKDELRQGMGLTAAAEVFNTHLISIEEYKNSATSILESENLVVRIKETYMPWKKAARIILGKVVFDLDLDIHPD
DVISVEENESTKPKDDEETAVTTPSSSGRRWRLWPIPFRRVKTIEHTSSNSSSEEDLFVDSEPGLQNSPEVLSAAESRHE
SPRRQLVRTNVPTNEQIASLNLKDGQNMITFSFSTRVLGTQQVDAHIYRWRWDTKIVISDVDGTITKSDVLGQFMPLVGK
DWTQSGVAKLFSAIKENGYQLLFLSARAIVQAYLTRSFLNNLKQDGKALPNGPVVISPDGLFPALYREVIRRAPHEFKIA
CLEDIRKLFPKDYNPFYAGFGNRDTDELSYRKLGIPKGKIFIINPKGEVATGHRIDVKKSYTSLHTLVNDMFPPTSLVEQ
EDYNPWNFWKLPVEEVD*

DNA
ATGAGTTTGGTCGGAAGATTCGGGAGTTTGATTTCTCAAGGCGTTTACTCCGTCGCCACACCGTTCCACCCCTTCGGTGG
CGCCATTGACGTCATCGTCGTCCAACAAGAAGACGGCTCGTTCCGCAGCACTCCTTGGTACGTCAGGTTCGGTAAGTTCC
AAGGCGTTCTCAAAGGAGCGGAGAAGTTTGTGAAGATCTCCGTGAATGGCACCGAAGCTGATTTCCACATGTATCTCGAC
AACTCCGGCGAAGCGTATTTCATCAGAGAGGTTGATCCTACAGCAGCTAATGACAACACAGAGAACAACAATGGTAATGA
GAACAACGGTTTACGCCTTGAGCATAGTTTATCTGACGCTGGTGCTGAGAGAGAGGGTTTCAACTCTTTGAGTCGGCTTG
ATAGGACGGAGTCTGATTGTAACAGGAGGTATTATGATTTCCAGGATGATGATGATGATGATGATCCGCCTTCTCCTACC
TCTGAGTATGGGGAGGGTCAAGGATCGGACTCTGAAGTGGTTTTAGTGAGTGTTGATGGGCGTATACTAACGGCTCCTGT
CTCGGCGGCGGAGCAGGAGGCTGAGAATCTACGGTTGAATACTCCTCAGTTTCATTTGGCTCCTGGCGATGGGACTGAGT
TTTGTGAAGGTAATACTGAGTTTGCTTCCTCTGAGACTTCTTGGGATGCTGAGTTTATCAGCAAAGTAGAGTCATCTGAG
AAAGTAGATTCCCGTTCTCGTGATATTACCGTTAAAGATTCTCATTATACCGAACTGTCACAACCTGTCGATAATGCGAA
GTCTGAGGAGCCAGCTTCTACTTTTGAGGCTCAGAATCTAAAAGAAGGTGAGCTTCTACTTACTACCATCACAGAAGATG
TTAGAGGTGAAGATGAAGTGGCTCTTGTTGATGGTTCTGAATCTTCTACAACCCAACTAACAACAGAAGAAGTGAGAATA
ACCGAGGAATCAAGGATATCTATTGATGCTAATACGGAGTCAGAATGTGAAGATGACCACACAAAAACTTCTGCAGAAAC
TTCCATCTTAATAGAGTCAGAAGCATCTGAGAGAGTCTCTATAGATTCAACGAGGGAGGAAGATGAGCAACTAACTCCAT
CTAAACCAACTGAGGAGGATAACGAGAACAGGAACACTATGGATTCAGTGGCTGCAACTTCTAGTGTGGACATAGAACTG
AAGTATGAGCTATCACTTTGCAAGGACGAGCTTCGTCAAGGCATGGGACTCACCGCAGCTGCTGAAGTCTTTAACACGCA
TCTAATCTCCATAGAAGAATACAAAAACTCAGCAACATCGATCCTCGAAAGCGAAAATCTAGTCGTTAGGATTAAAGAAA
CATACATGCCGTGGAAGAAAGCTGCTCGAATCATACTTGGAAAGGTTGTGTTTGATCTAGACTTAGATATTCATCCAGAC
GATGTGATCTCCGTGGAGGAAAACGAATCCACCAAACCAAAGGATGATGAAGAAACTGCAGTAACAACTCCTTCTTCATC
TGGAAGAAGGTGGAGACTCTGGCCTATTCCTTTTAGAAGGGTGAAAACGATAGAGCATACGAGTAGCAACTCCTCGAGCG
AGGAAGATCTGTTTGTTGATTCTGAGCCTGGCTTGCAGAACTCGCCGGAGGTGCTGTCAGCCGCAGAGAGCCGCCATGAG
TCTCCGCGTAGGCAGCTTGTGAGAACCAATGTCCCTACTAATGAGCAGATCGCGTCTCTGAATCTTAAAGATGGTCAGAA
TATGATCACTTTTAGTTTCTCCACGAGAGTTCTTGGAACACAACAGGTTGATGCACATATTTACCGGTGGAGATGGGACA
CTAAGATTGTAATTTCAGATGTTGATGGAACTATAACTAAATCTGATGTGCTAGGTCAGTTCATGCCATTGGTTGGAAAG
GACTGGACACAATCTGGTGTGGCCAAGCTTTTTTCAGCCATTAAGGAGAATGGGTACCAGCTGCTGTTTCTGAGCGCTCG
TGCCATTGTTCAGGCATATCTAACAAGAAGTTTCTTAAATAATCTAAAGCAGGACGGAAAAGCTTTACCAAACGGTCCTG
TAGTCATTTCACCAGACGGGCTGTTTCCAGCATTGTACCGTGAAGTGATAAGAAGAGCACCTCACGAATTCAAGATCGCA
TGTTTGGAGGATATCAGGAAACTCTTCCCAAAGGATTACAACCCGTTCTACGCTGGATTTGGGAACAGAGACACCGATGA
GCTGAGTTACAGGAAACTCGGAATCCCCAAGGGAAAGATATTCATTATCAATCCAAAGGGAGAAGTAGCAACAGGACATC
GCATAGATGTTAAGAAGTCGTACACATCACTTCATACCCTTGTGAACGACATGTTTCCTCCAACTTCACTTGTTGAGCAG
GAAGATTATAACCCATGGAACTTCTGGAAATTACCAGTTGAAGAAGTTGACTGA