Details for Chinese cabbage Locus Brara.E03080

Position : A05 ( 5`- 25502232 .. 25503656 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03080

Protein [Map View]
MPLAISLPTSSPPHLSPLRRRHHANLRNRRVSLARSSTKENQTETGVIIVGAGLAGLAAATRLASQRIPFLLLEASDGVG
GRVRTDIVDGFFLDRGFQIFITAYPEAKKLLDYKALDLQRFYAGAKVFYGGEFHTVADPLRHLWDSVASLTNPIGSVVDK
GLIALTRARVLVKSDEEILMASDEVPTIDLLRGIGFSDEILDRFFRPFFGGIFFDRDLETTSKLFDFIFRCLALGENTLP
SMGIGEIPNQLAAKLPADCVLMNSRVASLEYPNGSDSGPPVVRLQDGGVLKGELGVVLAVEQPQVDKLLNGIREPVVSRP
ARSTVCIYFTAEPDQIPVQDPVLFLNGSNTGIINNMFFPTNVARTYAPPGKALVSVSLIGSFEDRSDEDLAAEVIRELSG
WFGESLVMSWRHLRTYRIHFAQPNQCPPTDLVKNPRVGSGLYLSGDYMTSATFDGALVSGRRAVEALLREKGLV*

DNA
ATGCCACTGGCGATCTCTCTCCCAACCTCATCTCCTCCTCACCTCTCCCCTCTCCGCCGCCGCCATCATGCAAATCTCCG
AAACCGTCGCGTCTCCTTAGCTCGATCTTCCACCAAAGAGAATCAGACCGAGACGGGCGTCATCATCGTCGGCGCCGGAC
TCGCCGGCTTAGCCGCCGCGACTCGCCTCGCCTCCCAACGAATCCCTTTCCTGCTCCTCGAAGCTTCCGACGGCGTCGGC
GGTCGCGTCCGCACAGACATCGTCGACGGCTTCTTCCTCGACAGAGGGTTTCAGATTTTCATCACCGCCTATCCCGAAGC
CAAGAAGCTTCTCGATTACAAGGCCCTTGATCTGCAGAGATTCTACGCCGGAGCTAAGGTTTTCTACGGCGGGGAGTTTC
ACACGGTGGCCGATCCTCTCCGTCATTTGTGGGACTCGGTGGCTTCTCTAACGAACCCGATCGGATCCGTTGTTGACAAG
GGGCTCATCGCGTTGACGAGAGCTAGAGTTCTGGTTAAATCGGACGAAGAGATATTGATGGCCTCCGACGAAGTTCCGAC
TATTGATCTCCTCCGGGGCATCGGGTTCTCCGATGAGATACTCGATCGTTTTTTTCGACCGTTCTTCGGCGGGATTTTCT
TTGATAGAGACCTCGAAACGACGTCGAAGCTGTTCGATTTTATTTTCAGGTGTCTTGCTCTCGGAGAAAACACGCTTCCC
TCCATGGGGATCGGAGAGATCCCTAACCAGCTGGCGGCGAAACTACCAGCTGATTGCGTCTTGATGAACTCTAGAGTCGC
TTCGTTGGAGTATCCGAACGGGTCGGATTCGGGTCCGCCTGTAGTGAGACTCCAAGACGGCGGCGTTTTGAAGGGAGAGT
TGGGTGTTGTACTCGCCGTCGAGCAACCCCAAGTGGATAAGCTTCTAAACGGTATTAGAGAACCGGTTGTATCTAGACCG
GCTCGGAGCACTGTTTGTATTTACTTTACAGCTGAACCGGATCAGATACCGGTGCAAGATCCGGTTCTGTTTCTCAACGG
GTCGAATACCGGTATCATCAACAACATGTTTTTTCCGACGAACGTTGCTCGGACGTACGCGCCGCCGGGGAAGGCTCTGG
TTTCGGTATCGTTGATCGGTTCGTTTGAGGATAGATCCGATGAGGATTTAGCAGCAGAGGTTATCAGAGAGCTGTCTGGT
TGGTTCGGTGAGTCTTTGGTTATGTCATGGAGACATTTGAGAACATACCGGATCCATTTCGCCCAACCGAACCAATGCCC
ACCCACTGATTTGGTTAAGAATCCCCGGGTTGGGTCAGGTCTTTACTTAAGCGGTGATTACATGACTTCTGCTACATTTG
ACGGTGCTTTGGTCTCTGGGAGACGAGCTGTGGAAGCTTTGTTACGAGAAAAGGGACTAGTCTGA