Details for Chinese cabbage Locus Brara.E03078

Position : A05 ( 5`- 25495956 .. 25498834 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03078

Protein [Map View]
MSSSPTRNPTSAEVPPPLSSTSTDAEGSSKKVRKPYTITKSRESWTEEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIR
SHAQKYFLKVQKNGTLAHVPPPRPKRKAAHPYPQKASKNAQMPLQVSTSFTSRNSDMAGGYTSWDDVSMMLNRVISPRQE
LATLRGAEDNIGSTGLLNVSSPSTSVMGSSSRTLSGSDIIVQQAQQPPVLQAVPDFAEVYNFIGSVFDPEKRGHVEKLKE
MDPVNFETVLLLMRNLTVNLSNPDLESARNVLSSDEVNTEIPSVTTGSFVPNSTSDKSDS*

DNA
ATGAGCTCCTCGCCGACAAGGAATCCGACGTCTGCTGAAGTGCCACCACCGTTATCATCAACATCGACTGATGCGGAGGG
TTCGTCGAAGAAGGTGAGGAAACCTTATACCATCACCAAGTCTAGGGAGAGCTGGACAGAGGAAGAGCACGATAAGTTCT
TGGAAGCGCTTCAACTGTTTGATCGTGACTGGAAGAAGATAGAAGATTTCGTGGGTTCCAAGACAGTTATTCAGATAAGG
AGTCATGCACAAAAATACTTTCTAAAGGTTCAGAAAAACGGGACACTAGCACACGTTCCACCCCCTCGGCCTAAGCGCAA
AGCAGCTCACCCTTATCCTCAAAAAGCATCCAAGAACGCTCAAATGCCACTTCAAGTGTCCACTTCATTTACTAGTCGAA
ATAGCGACATGGCTGGTGGATATACTTCGTGGGACGACGTATCAATGATGCTTAACAGAGTCATTTCACCACGACAGGAA
CTTGCTACTCTTCGTGGAGCAGAAGATAATATTGGGTCGACGGGCTTATTAAATGTTAGTAGCCCTTCGACCTCCGTTAT
GGGAAGCTCAAGCCGAACACTATCAGGTTCTGATATTATAGTACAACAGGCACAACAACCTCCGGTGCTTCAAGCTGTTC
CTGATTTTGCTGAAGTTTATAACTTCATTGGGAGTGTCTTTGATCCTGAAAAGAGAGGCCACGTGGAAAAGCTCAAGGAA
ATGGATCCTGTAAACTTTGAAACTGTTCTGTTATTGATGAGAAACCTCACAGTTAACTTATCAAACCCTGATTTGGAATC
CGCAAGGAACGTGCTCTCATCAGATGAGGTGAACACCGAGATCCCAAGTGTTACCACTGGTTCCTTTGTTCCCAACTCAA
CAAGCGACAAATCTGATTCATGA