Details for Chinese cabbage Locus Brara.E03076

Position : A05 ( 5`- 25491099 .. 25492909 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03076

Protein [Map View]
MATSAARPLVTIQGLDGDMTTDQSSTIVLPDVMTAPVRPDIVSFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSR
IPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRKWHRRVNVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVS
DSAEAVEKTAAAIKVLKQIGAYDDAEKAKDSIGIRSGVGKMRNRRYICRKGPLVVYGTEGSKIVKAFRNLPGVELCHVER
LNLLKLAPGGHLGRFVVWTKSAFEKLEGIYGSFEKPSEKKKGYVLPRAKMVNADLARIINSDEVQSVVKPIKKDAKRAVM
KKNPLKNLNVMLKLNPYAKTAKRMSLLAEAQRVKAKKEKLTKKRKTVTKEESLAIKAAGKAWYQTMISDSDYTEFDNFTK
WLGASQ*

DNA
ATGGCTACCTCCGCCGCACGTCCTCTCGTCACCATCCAAGGCCTAGACGGCGACATGACCACCGACCAATCCTCCACCAT
CGTCCTCCCCGACGTCATGACCGCCCCCGTCCGTCCCGACATCGTCAGCTTCGTCCACGCTCAAATCTCCAACAACTCCC
GCCAGCCCTACGCCGTCTCCAAGAAGGCCGGTCACCAGACCTCCGCCGAGTCGTGGGGAACCGGACGCGCCGTCTCCCGT
ATCCCCCGTGTCCCCGGAGGAGGTACTCACCGCGCAGGACAAGCTGCCTTCGGTAACATGTGTCGTGGTGGACGTATGTT
CGCTCCGACCAAGATCTGGCGCAAATGGCACAGGCGCGTGAACGTCAACATGAAGAGGCACGCTATTGTCTCTGCCATTG
CAGCGACTGCTGTTCCTGCTCTTGTGATGGCGCGTGGGCATAAGATTGAGAATGTCCCCGAGATGCCTCTTGTGGTGAGT
GACTCAGCAGAAGCCGTGGAGAAGACGGCAGCTGCTATCAAGGTGTTGAAGCAGATTGGTGCTTATGATGATGCTGAGAA
GGCGAAGGATAGTATTGGGATTAGGTCTGGTGTGGGGAAGATGAGGAACCGTCGTTACATTTGTCGGAAAGGTCCTCTTG
TGGTTTACGGTACCGAAGGGTCTAAGATTGTCAAGGCGTTTAGGAACTTGCCTGGTGTTGAGCTTTGCCACGTGGAGAGG
CTTAACTTGTTGAAGCTTGCTCCTGGTGGTCATCTCGGGAGGTTTGTGGTTTGGACTAAGAGTGCTTTTGAGAAGCTTGA
GGGGATCTATGGATCGTTTGAGAAGCCTTCGGAGAAGAAGAAGGGGTATGTGCTTCCTAGGGCGAAGATGGTGAATGCTG
ATTTGGCGAGGATTATTAACTCTGATGAGGTGCAGAGTGTGGTGAAGCCGATTAAGAAGGATGCGAAGAGGGCTGTGATG
AAGAAGAATCCTTTGAAGAATTTGAATGTGATGCTGAAGTTGAACCCGTATGCTAAGACCGCGAAGAGGATGTCGTTGTT
GGCGGAGGCGCAGAGGGTTAAGGCTAAGAAGGAGAAGCTCACCAAGAAGAGGAAGACTGTCACCAAGGAGGAGTCATTGG
CGATCAAGGCCGCAGGGAAGGCGTGGTACCAGACTATGATCTCCGACAGCGACTACACCGAGTTCGATAACTTCACTAAA
TGGCTCGGTGCTAGCCAGTAA