Details for Chinese cabbage Locus Brara.E03074

Position : A05 ( 5`- 25483333 .. 25488237 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03074

Protein [Map View]
MGVYGDGSEGASMTSRRRGSIGVDSVDIAKILAVYFRDNENSCIDEEKLMFTAELIRIFSSPSGRDLVSQVDEEGGGSFS
LPLDLQQFKKLCDIENFFINLEDNPKGVLPCMNAAVHKVLLSQWETNGFDDVMKINIRLHNYPESSISLKNLRAAYIGKL
VTVHGTVVKVSTVKPLVTQMAFDCAKCKTSITRDFTDGKFSPPQNCDTHGCKSKMFIPLRSSAQTIDFQKIRVQELQKPE
DHEEGRVPRTVECELMEDLVDTCIPGDVVTVTGIIGVINNYMDIGGGKSKSKNQGFYYLFIEAVSVKNSKKQSAFENSED
SGSGVQSADVGDLYSFSQRDLEFIVKFNEEYGSDTFRRILHSVCPSIYGHEIVKAGITLSLFGGVRKHSMDRNKVPVRGD
IHVIIVGDPGLGKSQLLQAASAISPRGIYVCGNATTKAGLTVAVVKDSMTNDYAFEAGAMVLADGGVCCIDEFDKMTNEH
QALLEAMEQQCVSVAKAGLVASLSARTSVIAAANPVGGHYNRAKTVNENLKMSAALLSRFDLVFILLDKPDELLDKQVSE
HIMSLHSGGGEALPALKKFKTASGSANIHAKEGSLLSRLRLDPKKDDDFTPIPGQLLRKYVAYARTFVNPKMSKAAGEII
QKFYLKLRDHNTSADSTPITARQLESLVRLAQARARVDLREDITVQDAMDVVEIMKESLYDKFVDEHGVVDFGRSGGMSQ
QKEARRFLSALDKQSELQQKDCYSVSELYSLADRIGLRVPDIDTFLENLNTAGYLLKKGPKTYQVLSSSYSRSQSSRSR*

DNA
ATGGGTGTATACGGAGATGGAAGCGAGGGGGCAAGCATGACGTCGAGACGACGTGGATCGATCGGGGTTGATTCTGTCGA
TATCGCGAAGATATTAGCTGTGTATTTCAGAGATAACGAGAACTCGTGCATCGACGAGGAGAAGCTGATGTTCACGGCGG
AGCTTATCCGGATATTCTCTTCGCCGAGTGGTAGAGACTTAGTTTCTCAGGTGGATGAAGAAGGTGGCGGTTCCTTCTCT
TTACCGCTTGATCTTCAACAATTTAAGAAGTTATGCGATATCGAGAATTTTTTCATTAATTTGGAGGATAATCCCAAAGG
AGTCCTCCCATGTATGAATGCTGCAGTTCACAAGGTTTTACTAAGTCAATGGGAGACTAATGGCTTTGATGATGTTATGA
AGATCAATATTCGTCTGCATAATTATCCTGAATCTTCAATCTCTCTGAAAAACCTCAGAGCAGCATATATTGGTAAGCTT
GTAACAGTTCATGGGACCGTTGTTAAAGTTAGTACTGTGAAGCCTCTTGTGACACAGATGGCTTTTGACTGTGCAAAGTG
TAAAACTAGCATAACCCGGGATTTTACTGACGGAAAGTTTTCACCTCCGCAAAATTGTGACACCCATGGATGTAAGTCCA
AGATGTTTATTCCACTCCGATCCTCCGCTCAGACCATTGATTTTCAGAAAATCAGGGTACAGGAGTTGCAAAAGCCTGAA
GACCATGAAGAAGGAAGGGTACCCCGAACTGTAGAATGTGAGCTGATGGAAGACCTTGTGGACACATGTATCCCTGGTGA
TGTGGTGACTGTTACAGGGATTATAGGTGTAATTAACAATTACATGGATATTGGGGGAGGGAAATCTAAGTCCAAGAATC
AAGGATTCTACTATTTGTTTATAGAGGCAGTTTCAGTTAAAAACTCTAAGAAGCAGTCTGCATTTGAGAACTCAGAAGAC
TCCGGTAGTGGGGTCCAGTCTGCAGATGTTGGTGATTTATATTCATTCTCACAGAGAGACTTGGAATTTATTGTTAAGTT
CAACGAAGAATATGGTTCTGATACATTCCGTCGTATACTTCATTCTGTTTGTCCATCTATTTATGGCCATGAAATTGTCA
AAGCTGGAATAACACTGTCCCTGTTTGGAGGTGTAAGGAAGCATTCGATGGATCGGAACAAAGTTCCAGTCAGAGGAGAT
ATTCATGTCATTATTGTTGGTGACCCTGGATTGGGAAAAAGTCAGCTCTTGCAAGCAGCATCGGCCATCTCCCCTCGTGG
CATCTATGTATGTGGTAATGCGACGACTAAAGCAGGGCTCACCGTTGCTGTAGTGAAAGATTCTATGACAAATGACTATG
CGTTTGAGGCTGGTGCCATGGTACTTGCAGATGGCGGGGTTTGCTGCATTGACGAGTTCGATAAAATGACCAACGAGCAT
CAGGCTTTGCTAGAAGCAATGGAACAACAATGTGTCTCTGTTGCAAAGGCTGGGCTTGTGGCCAGTCTATCAGCTCGGAC
TTCTGTTATAGCAGCAGCAAATCCTGTTGGTGGCCACTACAACCGTGCAAAAACTGTAAACGAGAACTTAAAGATGAGTG
CTGCGCTTCTCTCGCGGTTTGATTTGGTTTTCATATTACTTGACAAACCTGATGAGCTACTCGACAAGCAAGTCTCAGAG
CATATTATGTCGCTTCATTCTGGAGGTGGAGAAGCATTACCTGCATTAAAGAAGTTTAAGACAGCATCAGGATCTGCAAA
TATACATGCCAAAGAGGGTTCTCTACTCTCAAGACTGCGGTTAGACCCTAAGAAAGATGATGACTTCACTCCCATTCCTG
GCCAACTGCTTAGGAAATATGTTGCTTATGCAAGGACTTTCGTCAACCCTAAGATGTCAAAGGCAGCTGGAGAGATAATT
CAAAAATTTTACTTGAAGCTGAGAGACCATAACACATCCGCTGACTCAACACCAATAACAGCAAGACAACTGGAAAGTTT
GGTCAGGCTTGCCCAAGCGAGAGCTCGGGTTGACTTAAGGGAAGATATAACAGTCCAGGACGCAATGGATGTGGTTGAAA
TAATGAAAGAATCTTTGTATGATAAGTTCGTAGATGAACATGGGGTTGTGGATTTTGGTCGGAGTGGAGGAATGAGTCAA
CAAAAGGAGGCGAGACGCTTCTTAAGTGCTCTTGATAAGCAATCAGAGTTGCAGCAAAAAGATTGTTACTCTGTTTCGGA
GCTGTATAGTTTAGCTGATAGGATCGGGCTACGAGTTCCAGACATTGATACATTCCTAGAGAACCTGAACACTGCCGGCT
ACTTGCTCAAGAAGGGACCAAAAACTTACCAGGTCCTCTCCTCATCTTATTCTCGGAGTCAGTCATCCAGGTCAAGATGA