Details for Chinese cabbage Locus Brara.E03069

Position : A05 ( 5`- 25460399 .. 25462905 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03069

Protein [Map View]
MDDRDKALEEEHKDGDYAEIAEEEQLWRRGIVSSRAPQDTGDDLMRRNASLTSSPIGKRVNFSPMPSPRIFQRGASLSPC
SSSSRNRPNNNSLKNLIPKLTFKNKNSNNINMDIEKAADLAVGASPPSSGNARERSTWTLSNILAPRLKKTESLPVTPIA
HSNPGSTHGRYVVDQVASMKKGPPLPFHRSRSVPAFNKDGSLRQSGVFRVIPTPNRTPTRNINKLDDTNVDGGEDVPEEE
AVCRICMVELGEDSEAFKMECMCRGELALAHKECTIKWFTIKGNRTCDVCKQEVQNLPVTLLRMQDSHFNFGATEATHFR
QVKIQTNTTFDVYGCYLTGNSRPFFSVWQDVPILVIVSMLAYFCFLEQLLLTKMKSGAIAISLPFSCVFGLLASMTSTTM
VKKQYVWIYGTIQFGLVVFFSHIFFSLVHMQPVVSILLATVVGFGLTMSGATGIVEFSKWRRRRWTAELPSSSQVDPPPV
QSISGS*

DNA
ATGGATGATAGAGACAAAGCTCTTGAAGAAGAACATAAGGATGGAGATTATGCTGAGATTGCAGAGGAAGAGCAGCTATG
GAGGCGAGGCATTGTCTCATCAAGAGCACCACAAGATACGGGAGATGATCTAATGAGACGTAATGCATCCTTAACATCAA
GCCCTATTGGCAAAAGAGTCAACTTCTCTCCAATGCCCAGCCCTAGAATCTTCCAGCGTGGTGCTTCCCTCAGTCCTTGT
TCGTCCTCTTCAAGAAACAGACCTAACAATAATAGCCTGAAGAATCTGATCCCAAAGTTGACCTTCAAAAACAAGAACAG
CAATAACATTAACATGGATATCGAGAAAGCTGCGGATTTGGCCGTTGGTGCGTCCCCTCCTTCTTCAGGAAACGCCAGGG
AGAGATCTACATGGACGCTCAGTAATATTTTAGCTCCAAGGTTGAAGAAAACTGAGTCCTTGCCAGTAACCCCTATAGCT
CACTCGAACCCTGGGTCCACACATGGGAGATATGTGGTTGATCAGGTTGCTTCCATGAAGAAAGGGCCTCCACTGCCTTT
TCACCGATCACGCTCTGTTCCAGCATTCAACAAAGATGGAAGTCTAAGGCAATCAGGTGTTTTCCGGGTGATTCCTACTC
CGAACAGGACACCAACCAGAAATATTAATAAACTTGACGACACGAATGTTGATGGCGGAGAAGATGTTCCTGAGGAAGAA
GCCGTGTGCAGAATCTGCATGGTAGAATTGGGAGAAGATTCGGAAGCCTTCAAGATGGAGTGTATGTGTAGAGGTGAATT
AGCTCTTGCACACAAAGAGTGTACAATCAAATGGTTCACCATTAAAGGAAACAGAACATGCGACGTGTGCAAGCAAGAGG
TTCAGAACCTCCCTGTCACCCTTCTCCGCATGCAGGATTCTCATTTTAATTTTGGAGCTACCGAGGCTACTCACTTCAGG
CAAGTCAAAATCCAAACAAATACCACATTCGATGTTTATGGATGTTATTTGACCGGTAACTCTCGTCCTTTTTTCAGTGT
ATGGCAGGACGTTCCAATTCTTGTCATTGTAAGCATGCTTGCATACTTCTGTTTCCTCGAGCAGCTTCTGCTAACCAAAA
TGAAATCAGGCGCCATTGCAATATCTTTACCTTTCTCTTGTGTTTTTGGTCTTCTTGCCTCGATGACGTCAACTACAATG
GTGAAGAAGCAATATGTATGGATTTACGGCACAATTCAGTTCGGTCTTGTAGTTTTTTTCTCTCACATTTTCTTCTCATT
GGTTCACATGCAGCCGGTTGTGTCTATTCTCTTAGCCACAGTGGTTGGTTTCGGACTCACCATGAGCGGTGCAACGGGTA
TCGTCGAGTTTTCAAAATGGAGGAGACGCCGGTGGACAGCTGAACTTCCAAGCAGTAGTCAGGTGGATCCACCACCAGTT
CAGAGTATCTCTGGATCATGA