Details for Chinese cabbage Locus Brara.E03067

Position : A05 ( 5`- 25451726 .. 25454258 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03067

Protein [Map View]
METHLFLLFLSLLLFLSKPGSGFGSPGPIAASFGGSSAFFCAIDASGRQEVICWGKNYSSPSSPSSSSSSTSQSYNIPSM
AVLSGGDGFLCGVLSNTSQPFCFSSLGSSSSGTDLVPLSYRTTAYSQIAAGNRHVCAVRGAYYSDHDSGTVDCWEITRAT
NNSFVAKESPNFYDQNVSNLVFNKIVSGDGFSCGGVREGGVLCFGPKSSTLGLNTTTSDSFEVLAAGKSSLCAILNSSRE
IKCWGDEDSFVNSPSDDSRFVALASGPNHYCGIREDTHEVECWGNANFSLIPKASGFKAIASSDSIVCGIREEDLVLDCW
MVDGSSTLAYDPPLELCSPGVCRAGPCGDKEFAFNASILDEPDLTSLCVRKELSLCSPCGSDCSKGFFLSSSCTENSDRV
CTSCSLCQNSSCSDICKVHNRDSSSDKHWNQLALIVGSSASALLIIIICCCVVPRFVTSPNKEDGFKSCIGKTDLETEPL
EMIAPATSVTPFAQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLSDGRQVAVKRANASTIIHTNAREFEAELEILCN
IRHSNIVNLIGYSTEMGERLLVYEYMPHGTLHDHLHGGFSPLSWGLRVRIALQTAKGLEYLHVEAEPRIVHGDVKSSNVL
LDSEWVGRVADFGLLTSSNERSLDVKGDVYDFGVVLLEILTGRKRYDRDCDPPEIVEWAVPVIREGKAAAILDKYIALPR
NVEPLLKLADVAELCVREDPSQRPTMSELVNLLDQFARDGLIL*

DNA
ATGGAAACTCATCTCTTTCTCCTCTTTCTCTCACTCCTCCTATTCTTATCCAAACCCGGATCCGGATTCGGATCCCCCGG
CCCTATAGCGGCCTCCTTCGGCGGCTCCTCTGCTTTCTTCTGCGCCATTGACGCTAGCGGACGCCAAGAAGTTATCTGCT
GGGGCAAAAACTACTCATCTCCTTCTTCTCCATCTTCCTCCTCTTCTTCAACTTCTCAAAGCTACAACATTCCTTCCATG
GCCGTTCTCTCGGGCGGAGACGGGTTCCTCTGCGGAGTCTTGTCCAACACGTCTCAGCCCTTTTGTTTCAGTTCACTTGG
ATCTTCCTCCTCGGGTACGGATCTTGTCCCTCTCTCTTACAGGACCACTGCTTACTCCCAGATCGCTGCTGGAAACAGAC
ATGTCTGTGCAGTCAGAGGAGCTTACTATTCCGACCACGACTCTGGAACCGTAGACTGTTGGGAGATAACAAGAGCTACC
AATAACAGTTTTGTCGCGAAAGAGAGTCCTAACTTCTACGATCAGAACGTTAGTAACCTCGTCTTCAACAAGATTGTTTC
TGGTGATGGGTTTAGCTGTGGTGGAGTTAGAGAAGGTGGGGTCCTCTGTTTTGGTCCAAAGTCTTCTACTTTAGGGCTTA
ACACAACAACTTCAGACAGCTTCGAAGTGTTAGCCGCGGGAAAAAGCTCTCTCTGCGCGATTCTAAACTCATCTCGTGAG
ATTAAATGTTGGGGAGACGAGGACTCTTTTGTTAACTCACCATCTGATGACTCTCGCTTCGTTGCGTTAGCATCTGGTCC
TAACCATTACTGTGGGATCCGCGAAGATACTCACGAGGTTGAGTGTTGGGGCAACGCTAACTTCTCGCTGATACCTAAAG
CTTCCGGCTTTAAGGCTATTGCGTCGTCGGACTCCATCGTTTGCGGTATAAGAGAAGAGGATCTCGTTCTCGACTGCTGG
ATGGTTGACGGGTCGTCAACACTAGCGTACGATCCTCCTTTAGAGCTTTGCAGTCCAGGGGTATGTAGAGCTGGTCCTTG
TGGAGATAAAGAGTTTGCTTTCAACGCAAGCATCCTCGACGAGCCTGACCTAACGAGTTTATGCGTGAGGAAAGAGTTGT
CTCTCTGTTCTCCTTGCGGATCGGATTGCTCTAAGGGGTTCTTCTTGTCGAGTTCGTGCACCGAGAACTCTGACCGGGTA
TGTACCTCGTGTTCGTTATGTCAGAACAGTTCTTGTTCCGACATTTGTAAGGTTCACAACCGAGATTCTTCTTCAGACAA
ACATTGGAATCAGCTTGCTCTCATCGTCGGCTCTTCCGCCTCGGCTCTGTTGATCATCATCATCTGTTGTTGCGTCGTGC
CACGGTTTGTTACTAGTCCTAACAAAGAAGACGGTTTCAAATCTTGCATAGGAAAGACCGATCTAGAAACCGAGCCACTC
GAAATGATCGCCCCTGCTACATCGGTAACACCCTTCGCGCAAGTGTTTAGGCTCTCCGAGCTTAAAGACGCGACCAACGG
GTTCAAAGAGTTCAACGAGCTAGGCCGAGGAAGCTACGGGTTCGTCTACAAAGCCGTGTTATCCGACGGGAGACAGGTCG
CGGTTAAAAGAGCTAACGCATCTACCATAATCCACACGAACGCTAGAGAGTTCGAAGCCGAGCTGGAGATTCTATGCAAC
ATTAGGCATAGCAACATCGTGAACCTCATCGGTTACTCCACCGAGATGGGAGAGAGGCTTCTTGTCTACGAGTACATGCC
TCACGGTACGCTTCACGACCATCTCCACGGCGGGTTTTCGCCGTTGAGTTGGGGGTTAAGGGTTCGAATCGCGTTGCAAA
CAGCGAAGGGGCTCGAGTATCTTCACGTTGAAGCTGAGCCGAGGATTGTTCACGGTGATGTGAAGTCCTCGAACGTGCTT
TTGGACTCGGAGTGGGTGGGTAGAGTGGCGGATTTTGGGCTTCTGACGTCGTCTAACGAGAGGAGTTTGGACGTCAAAGG
TGATGTTTATGACTTTGGGGTTGTGTTGTTGGAGATTTTGACCGGGAGGAAGCGTTACGATAGGGATTGTGATCCTCCGG
AGATTGTTGAATGGGCTGTTCCGGTGATCAGAGAAGGCAAAGCGGCGGCGATTTTGGATAAGTATATTGCTTTGCCGAGA
AATGTTGAGCCGTTGTTGAAACTTGCTGACGTGGCGGAGTTGTGTGTACGGGAGGATCCGAGTCAACGACCAACCATGTC
GGAACTTGTGAACTTGTTGGATCAGTTCGCTAGAGATGGACTGATCTTGTAG