Details for Chinese cabbage Locus Brara.E03066

Position : A05 ( 5`- 25449082 .. 25451217 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03066

Protein [Map View]
MSGTHDSCPLVKNILLLDSEGKRVAVKYYSDDWATNAAKLSFEKYVFSKTSKTNARTEAEITLLDSNIIVYKFAQDLHFF
VTGGDDENELVLSSVLQGFFDAVALLLRNNVEKMEALENLDLIFLCLDEMVDQGVVLEMDPNVIAGKVAMQSTEASGSLS
EQTLTQALATAREHLARSLLT*

DNA
ATGTCAGGGACTCATGATTCATGTCCTTTGGTGAAGAACATTCTTCTTCTGGACTCTGAAGGGAAGCGTGTGGCTGTCAA
GTACTACTCTGATGACTGGGCAACTAATGCTGCCAAGTTGAGTTTTGAGAAGTACGTGTTCTCCAAGACCTCTAAGACCA
ATGCTCGCACAGAAGCTGAGATCACACTCTTGGACAGTAATATTATTGTCTATAAGTTCGCCCAGGACCTTCACTTCTTT
GTCACTGGAGGCGATGATGAAAACGAGCTCGTCTTGTCCTCTGTTCTTCAAGGCTTTTTCGATGCTGTTGCACTTCTTCT
AAGGAACAATGTGGAAAAGATGGAAGCTCTTGAGAACTTGGATCTCATCTTTCTCTGCCTCGATGAAATGGTCGATCAGG
GGGTGGTTCTTGAAATGGACCCGAACGTCATTGCCGGGAAAGTAGCAATGCAGAGCACAGAAGCTAGTGGTTCACTCTCT
GAACAGACACTAACTCAGGCATTGGCAACAGCTCGGGAACATCTGGCAAGAAGTCTGCTTACATGA