Details for Chinese cabbage Locus Brara.E03065

Position : A05 ( 5`- 25446057 .. 25448340 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03065

Protein [Map View]
MAAFLARRLLGTSTSSSSALMSSARAFSSSTTPIKATLFPGDGIGPEIAESVKQVFTAADVAIDWDEHYVSTEVDPRTNS
FLTWESLQSVLDNKVGLKGPMATPIGKGHRSLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEYSGLEH
QVVKGVVESIKIITRKASMRVAEYAFLYAKTHGRKKVSAIHKANIMQKTDGLFLQCCDEVAEKYPEIEYEKVVIDNCCMM
LVKNPALFDVLVMPNLYGDIISDLCAGLVGGLGLTPSCNIGEDGIALAEAVHGSAPDIAGKNLANPTALLLSGVMMLRHL
KLNKQAEQIHSAIINTIAEGKYRTADLGGTSTTTEFTKAICDHL*

DNA
ATGGCAGCTTTTCTCGCGAGACGGCTTCTCGGCACTTCAACGTCTTCCTCCTCAGCGCTCATGTCCTCTGCTAGAGCCTT
CTCCTCCTCCACCACTCCGATCAAAGCAACCCTCTTCCCCGGCGACGGGATCGGTCCCGAGATCGCCGAATCCGTCAAAC
AGGTGTTTACTGCTGCTGACGTGGCAATTGATTGGGACGAGCACTATGTCAGCACTGAAGTGGATCCGAGAACCAACAGT
TTCTTGACGTGGGAGAGTCTTCAGTCCGTGCTTGATAACAAGGTTGGCTTGAAAGGACCTATGGCTACTCCCATTGGGAA
GGGTCACCGTTCCTTGAACCTTACTCTTAGGAAGGAGCTGAATCTGTACGCTAATGTTAGGCCGTGTTACAGCCTCCCTG
GGTATAAGACTCGTTATGATGACGTTGATCTTATTACTATTCGTGAGAACACTGAAGGAGAGTACAGTGGGCTTGAGCAT
CAGGTGGTTAAGGGTGTGGTGGAGAGTATTAAGATTATTACACGTAAGGCGAGTATGAGAGTTGCGGAGTATGCTTTTCT
CTATGCTAAGACTCACGGAAGGAAGAAAGTTTCTGCAATTCATAAAGCCAACATTATGCAGAAAACTGATGGTCTTTTCC
TTCAGTGCTGTGATGAGGTAGCTGAGAAGTATCCTGAGATAGAATACGAGAAGGTTGTTATTGACAACTGCTGTATGATG
CTTGTGAAAAACCCAGCACTTTTTGATGTGTTGGTGATGCCAAATCTCTATGGAGATATTATCAGCGATTTGTGTGCTGG
ACTAGTTGGGGGACTAGGACTGACTCCAAGTTGTAATATCGGGGAGGATGGTATTGCCCTTGCTGAAGCTGTGCACGGGT
CTGCACCAGATATTGCCGGAAAGAACTTGGCGAACCCGACAGCTTTGCTTCTGAGTGGAGTGATGATGTTGCGGCATCTG
AAGCTCAACAAACAAGCAGAGCAAATTCATAGCGCCATCATCAACACAATAGCGGAGGGGAAGTATAGAACCGCTGATCT
CGGAGGTACCTCAACCACAACAGAGTTCACAAAAGCCATCTGTGATCATCTCTAA