Details for Chinese cabbage Locus Brara.E03062

Position : A05 ( 5`- 25421908 .. 25424739 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03062

Protein [Map View]
MKCFFFSGGDKKDEHKTPNVSQTSNFSDRDINRSGSEFNSRDVSGTSTESSMGRRNSYPPTMSTRASNLREFSITDLKAA
TKNFSRSVMIGEGGFGCVYRGTVRSLEDPSIKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHTNLVKLLGYCAEDDERG
IQRLLVYEYMPNRSVEFHLSPRSLTILTWDLRLRIAQDAARGLTYLHEQMEFQIIFRDFKSSNILLDENWKAKLSDFGLA
RLGPSEGLTHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRKPVDRNKPKGEQKLLEWVRPYLSDTRKF
KLILDPRLEGKYPLKSVQKLAVVANRCLVRNPKARPKMSEVLEMVNKIVEAPSCSGTSPQLVPLKSLEASRDVGGGKKKR
GLENGGGEGGWFGKLWNPKTIRAC*

DNA
ATGAAGTGTTTCTTCTTCTCCGGAGGGGACAAGAAAGACGAACACAAGACCCCTAATGTCTCACAGACCTCCAACTTCTC
TGACCGCGACATTAACCGAAGCGGGTCAGAGTTCAACTCTCGAGACGTCTCTGGCACGAGCACGGAGTCATCCATGGGGA
GGAGGAACTCGTACCCTCCTACAATGTCTACTAGAGCAAGTAATCTCAGAGAGTTCAGCATCACTGATCTCAAGGCTGCA
ACAAAGAACTTTAGCAGGTCTGTCATGATTGGAGAAGGTGGCTTCGGTTGTGTCTACAGAGGAACAGTTAGGAGTTTAGA
AGATCCGTCTATCAAAATCGAAGTTGCTGTTAAGCAGCTTGGTAAAAGAGGGTTACAGGGGCATAAAGAATGGGTTACTG
AGGTTAACTTTCTTGGTGTGGTTGAGCATACAAACTTGGTGAAGTTGCTTGGTTATTGCGCAGAAGATGATGAGCGTGGG
ATCCAACGGCTTTTGGTTTATGAATACATGCCAAACCGAAGCGTTGAGTTCCACCTATCTCCTAGATCACTCACCATCCT
TACTTGGGATCTCAGGTTGAGAATAGCTCAAGATGCAGCTCGTGGTTTAACATACCTTCACGAACAAATGGAGTTTCAGA
TAATATTCAGAGATTTTAAGTCATCGAACATTCTTTTGGATGAGAACTGGAAAGCAAAGCTCTCTGACTTTGGTTTGGCT
CGTTTAGGTCCATCTGAAGGACTAACTCATGTTTCTACTGATGTTGTAGGTACAATGGGTTATGCAGCTCCTGAGTATAT
TCAAACAGGTCGTCTTACATCCAAAAGCGACGTTTGGGGTTATGGAGTGTTCATCTACGAGCTCATCACAGGGAGGAAAC
CAGTTGATAGGAACAAACCTAAGGGAGAACAGAAGCTTCTAGAATGGGTGAGACCTTATCTATCCGACACAAGGAAGTTC
AAGCTCATATTAGACCCGAGGCTAGAAGGGAAGTACCCTCTCAAATCAGTTCAGAAGCTAGCGGTTGTGGCCAATAGGTG
TTTAGTTAGAAACCCAAAGGCACGTCCCAAGATGAGTGAAGTGTTGGAGATGGTGAACAAGATTGTGGAAGCGCCTTCAT
GTAGCGGTACTAGCCCGCAGCTAGTTCCGTTGAAGAGTTTGGAGGCTTCCAGAGACGTTGGAGGAGGGAAAAAGAAGAGG
GGTTTAGAGAACGGTGGTGGTGAAGGAGGTTGGTTTGGTAAGTTATGGAACCCAAAGACAATAAGAGCTTGTTGA