Details for Chinese cabbage Locus Brara.E03060

Position : A05 ( 5`- 25415472 .. 25417676 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03060

Protein [Map View]
MRGGGKRRSSGGGGSGRSKSRSPGHRAAGSSSGGRRRRTNNTLFVEGGALADFPKDHSFSTPSRGRSSSRKGSKKPGSSD
RASGLRRCTGQSYAYQYPSGGDREMVGLGSNQLLLGKTDGNQIVAYIDDQTPSKEVVKVNYEYGSSFVLGGDDDETHKGL
GFESDAGPSGSLSKALGDETCEEGGDEAMPDVVKVKPSKRNSGFISIGGMKLYTEDISDDEESGGEEEEGSIGSEESEES
SDESESSADMFGSDTEIDDAVAKDYLEGIGGSENMLNAHWLAEKSLDQLDLSGGDTSGSDSSAEMKTGKKLTGFALQKAS
MEYGKKKVTRSHYSGHGKATMDDLMFVKDPRSLSGKKNKKTKFLPQSWPSGSQKSKHSRTFPGEKKKHRKEYIALKRRER
MLQRGVDLTDINIQLERFVLENVDMHCFQRMHNRDCSQVRRLADVYRLSSSCTGSGKKSFVTVTRTYQTCMPSASDKVRI
EKLIGAGDEEEDFAVSGGGVKVKSGGLERKKAKDSAKKRPTREERERNKSSGKKSSYAEQPVSFVSCGVIDSEIAVAKTS
SDVNVAKQVGETTPEASSGADIGAFEVHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLGLDFSIDTDE
ASPPINNNAKKNRSSSSGKQVKRGSHDIGGGSSSARIRDKRLGAFEQHTTGFGSRMMARMGFVDGSGLGRESQGIVNPLV
AVRRPRARGLGAEG*

DNA
ATGCGAGGCGGTGGCAAGAGAAGATCAAGCGGCGGCGGTGGTTCCGGGAGAAGCAAATCCAGATCTCCAGGACACCGCGC
GGCGGGTTCTTCCTCCGGCGGTCGTCGCCGACGCACCAACAACACTCTGTTCGTAGAAGGAGGCGCTCTCGCCGATTTCC
CGAAAGATCATTCCTTTTCGACGCCGTCTCGAGGGAGAAGCTCTTCCAGAAAAGGATCGAAGAAGCCCGGAAGCTCAGAT
CGTGCGTCTGGTCTGAGGAGATGCACTGGTCAAAGCTACGCCTATCAGTATCCTTCAGGCGGTGATCGTGAAATGGTTGG
ACTCGGATCGAATCAGTTACTGTTAGGGAAGACAGATGGGAACCAGATCGTTGCGTATATTGATGATCAGACGCCTTCGA
AGGAAGTTGTTAAGGTAAATTATGAGTATGGATCGAGTTTTGTTTTGGGTGGTGATGATGATGAGACTCATAAAGGTTTG
GGCTTTGAATCTGATGCTGGGCCAAGTGGTAGTCTTTCAAAGGCATTGGGAGATGAGACTTGTGAAGAGGGTGGAGATGA
AGCGATGCCTGATGTTGTGAAAGTGAAACCGTCTAAGAGGAATTCAGGTTTCATTTCTATTGGAGGGATGAAGCTTTACA
CTGAGGATATATCTGATGATGAAGAGAGTGGTGGAGAAGAAGAGGAAGGAAGCATTGGGTCTGAAGAGAGTGAGGAGTCA
TCTGATGAGAGTGAAAGCTCGGCGGATATGTTTGGAAGTGATACCGAGATTGATGACGCTGTTGCGAAGGATTACTTGGA
AGGTATTGGTGGAAGTGAGAATATGTTGAATGCTCACTGGTTGGCTGAAAAGTCATTAGATCAACTGGATTTGTCAGGCG
GTGACACTTCTGGAAGTGATTCTTCTGCTGAGATGAAGACAGGGAAGAAGTTGACTGGTTTTGCTCTACAAAAGGCGTCA
ATGGAGTATGGGAAGAAGAAGGTGACAAGAAGTCATTACTCTGGTCATGGTAAGGCTACAATGGATGATCTTATGTTTGT
GAAGGATCCAAGAAGTCTTTCGGGTAAGAAGAATAAGAAGACTAAGTTTCTTCCACAGTCTTGGCCTTCAGGGTCACAAA
AGAGCAAGCATTCTCGTACCTTTCCTGGTGAGAAGAAGAAGCATCGCAAAGAGTATATTGCTTTAAAGCGTCGTGAGAGA
ATGTTGCAGCGTGGTGTTGATCTTACTGATATAAACATTCAGTTAGAGCGTTTTGTTCTTGAAAACGTTGACATGCACTG
TTTCCAGCGTATGCACAACCGAGATTGCTCTCAGGTAAGGCGGTTAGCAGACGTGTACCGCTTATCAAGTAGCTGCACTG
GTTCTGGAAAGAAAAGCTTTGTGACGGTGACTCGAACGTATCAGACATGTATGCCATCTGCTAGCGATAAGGTTCGCATT
GAGAAGCTGATAGGAGCAGGAGACGAGGAGGAGGACTTTGCTGTCAGCGGAGGAGGGGTGAAGGTTAAATCTGGAGGGTT
AGAGAGGAAGAAAGCAAAAGACTCAGCCAAAAAGCGACCTACTAGAGAAGAACGGGAGAGAAACAAAAGCAGCGGGAAGA
AGAGTTCATATGCTGAGCAACCTGTTTCATTTGTGTCATGTGGTGTTATTGATTCTGAGATCGCTGTGGCAAAGACCTCT
TCTGATGTCAACGTTGCTAAACAAGTGGGTGAAACTACTCCGGAAGCCTCTAGTGGAGCAGATATTGGAGCGTTTGAGGT
GCACACCAGAGGCTTTGGATCTAAAATGATGGCAAAAATGGGATTCATAGAAGGAGGCGGTCTAGGAAAGGAGGGTAAGG
GGATAGCACAGCCAATAGAAGCTGTTCAACGTCCGAAATCACTTGGTTTAGGTCTGGATTTCTCTATTGATACCGACGAG
GCTAGTCCACCAATCAATAACAACGCTAAGAAGAACAGATCTTCTTCATCTGGGAAACAAGTGAAACGCGGCTCCCATGA
CATTGGTGGTGGTTCTAGCTCAGCAAGAATTAGAGATAAAAGATTGGGAGCCTTTGAGCAGCACACAACAGGTTTCGGTT
CGAGGATGATGGCGAGAATGGGTTTTGTGGATGGCTCGGGTTTGGGAAGAGAGTCGCAAGGCATAGTCAATCCGTTGGTC
GCTGTGAGACGTCCTAGAGCTCGTGGACTAGGCGCTGAAGGCTAA