Details for Chinese cabbage Locus Brara.E03059

Position : A05 ( 5`- 25413821 .. 25415005 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03059

Protein [Map View]
MEKYFGNAYRGDPGVPHADADRFVNIWIGSAAFSVLTWVNPYMWQLSNQFNYHDKWMLFEQHHWKKARAKKQPYEFKWNK
IPKEVRDSYYYNWPVYFP*

DNA
ATGGAGAAGTATTTTGGGAATGCGTATAGGGGAGATCCAGGAGTGCCGCACGCAGATGCTGATAGGTTCGTGAACATATG
GATTGGTTCGGCTGCCTTCTCTGTTCTCACATGGGTCAATCCTTACATGTGGCAGCTCTCCAACCAGTTCAATTATCATG
ATAAGTGGATGCTCTTTGAGCAGCACCACTGGAAAAAGGCAAGGGCGAAGAAGCAGCCTTACGAATTCAAGTGGAATAAG
ATACCAAAAGAAGTCAGGGACTCGTATTATTACAACTGGCCTGTCTACTTCCCTTAG