Details for Chinese cabbage Locus Brara.E03054

Position : A05 ( 5`- 25398582 .. 25400802 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03054

Protein [Map View]
MAAAPGRARSDYDYLVKLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRIKLQIWDTAGQERFRTI
TTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDSVNRILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSA
KTNLNVEQVFMSIAKDIKQRLTESDTKAEPQGIKIKKQDASKASSSSTTEKSACCSYV*

DNA
ATGGCGGCTGCGCCGGGAAGAGCTCGCTCAGACTATGATTACCTCGTCAAGCTCCTCCTCATCGGCGATAGCGGTGTGGG
GAAAAGTTGTTTGCTACTGCGTTTCTCGGATGATACTTTCACTACAAGTTTCATTACCACCATTGGAATCGATTTCAAGA
TAAGAACAGTTGAACTTGATGGGAAGCGTATCAAATTGCAGATATGGGACACTGCTGGACAAGAACGTTTTAGAACTATA
ACCACAGCTTATTACAGAGGAGCAATGGGTATATTACTCGTCTATGATGTAACAGACGAGTCATCCTTCAACAATATTAG
GAACTGGATGAAGAATATTGAGCAACATGCTTCAGATAGCGTCAACAGAATCTTGGTTGGTAACAAAGCTGACATGGACG
AAAGCAAAAGGGCTGTTCCAACATCAAAGGGACAAGCTCTGGCTGATGAATATGGAATCAAGTTCTTCGAGACGAGTGCA
AAAACAAACCTGAATGTGGAGCAGGTTTTCATGTCTATCGCTAAAGACATCAAACAAAGACTCACAGAAAGCGACACAAA
AGCTGAGCCACAAGGAATCAAGATCAAAAAACAAGATGCTAGCAAAGCCTCATCGTCTTCTACAACTGAGAAATCAGCTT
GCTGCAGTTATGTTTAG