Details for Chinese cabbage Locus Brara.E03051

Position : A05 ( 5`- 25371581 .. 25372457 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03051

Protein [Map View]
MAQRITTLVLLIEILFLLNYVSQIAKTAAANDGDVIHVTGKVMCQDCTLNYDQWINGSEPIKGAVVSITCMDERERVRYY
GSDKTDERGQFDLIVDKVLYGGKNLKPNLCNVRLVSPADQSCGIPTDFGNGQTGEKLVQPFMVFKNLVKFVVGPFYYTTP
MCDTPKYENNY*

DNA
ATGGCGCAGAGGATCACGACACTGGTTCTGCTCATAGAGATACTGTTTCTGTTAAATTATGTGAGTCAAATAGCCAAGAC
CGCAGCAGCTAACGACGGAGATGTGATTCACGTCACCGGGAAAGTGATGTGCCAAGATTGCACTCTTAACTACGACCAAT
GGATCAACGGCTCTGAACCCATCAAAGGGGCTGTGGTATCAATCACTTGTATGGACGAGAGGGAAAGAGTGAGATACTAT
GGCAGCGACAAGACCGATGAAAGAGGCCAGTTCGATCTTATCGTCGACAAAGTCCTCTACGGCGGAAAGAATCTCAAGCC
TAATCTTTGTAATGTCCGGCTCGTGTCTCCTGCTGACCAGTCATGTGGTATTCCGACCGATTTTGGCAATGGTCAAACCG
GAGAGAAGCTAGTTCAGCCGTTCATGGTTTTCAAGAATCTAGTGAAGTTTGTAGTCGGGCCATTTTATTATACCACCCCC
ATGTGTGACACCCCTAAATATGAAAACAACTACTAG