Details for Chinese cabbage Locus Brara.E03049

Position : A05 ( 5`- 25367282 .. 25367792 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03049

Protein [Map View]
MGKVSLLLNFLISHASKQESMEKFDRNGGSSSGFKMPLHYPKYTKDDYEKMEEWRLDLLLSDYGLIAFHDTSTLHEKRAI
AIETFLWPHAY*

DNA
ATGGGGAAAGTGAGCTTGCTTCTTAACTTTCTCATTAGCCATGCCTCCAAGCAAGAAAGCATGGAGAAATTTGACAGAAA
CGGAGGATCAAGCAGTGGGTTTAAGATGCCGTTGCATTACCCAAAATACACAAAGGATGATTACGAGAAGATGGAAGAGT
GGAGACTTGATTTGCTTCTCTCAGACTACGGACTCATTGCTTTCCACGACACTAGTACTCTCCATGAGAAGCGAGCTATT
GCGATCGAAACTTTTCTGTGGCCTCATGCGTACTAA