Details for Chinese cabbage Locus Brara.E03047

Position : A05 ( 5`- 25352657 .. 25354512 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03047

Protein [Map View]
MKEMQAIETSQPTVAPPAVHSRQLGAQLSGSMSFSSQMSKEDEEMSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEE
ETKRLALIREELEGLADPMRKEVALVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITKLMELVGESE
KVRMKKLEELSKNIDSIH*

DNA
ATGAAGGAGATGCAGGCAATAGAGACGTCACAGCCGACGGTGGCTCCTCCGGCGGTGCACAGCCGACAGCTAGGAGCTCA
GCTGTCGGGAAGCATGAGTTTCAGCAGCCAAATGTCGAAGGAAGACGAGGAGATGTCGAGGACGGCGTTGTCTGCTTTCA
GGGCGAAAGAAGAGGAGATCGAGAAGAAGAAGATGGAGATTAGGGAAAGGGTTCAAGCTCAGCTTGGTCGTGTCGAAGAG
GAGACTAAGCGTCTCGCTTTGATCCGTGAGGAACTTGAAGGTTTAGCTGACCCCATGAGGAAAGAAGTTGCTTTGGTCAG
GAAGAAGATTGATTCTGTTAACAAAGAGTTAAAGCCTTTGGGTCATACTGTTCAGAAAAAGGAACGAGAGTACAAAGAAG
CTCTTGAAGCATTCAATGAAAAGAACAGAGAGAAGGTGCAGCTTATCACCAAGCTTATGGAGTTAGTGGGAGAGAGCGAA
AAGGTGAGAATGAAGAAGCTGGAAGAGCTGAGCAAGAACATAGATTCTATACACTGA