Details for Chinese cabbage Locus Brara.E03045

Position : A05 ( 5`- 25346899 .. 25349696 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03045

Protein [Map View]
MASCDDDFSLLGGEDQSNPNQHHHHHHQVLHHAPYAPRRFAPKLSNQIHAPHHHQSNGDEDDEHHDVVASSAFHGVNPFS
TDENSNPYDNNNNNAAVEGGDEDLDANRSRIGGGARLEKRQSQEELSDGGTTNGGDTTPYGSFKRPRTSSSSAGEYRKDR
EEWSDAAITCLLDAYSDKFTQLNRGNLRGRDWEDVAATVSERCEKLIKSVEQCKNKIDNLKKRYKLERHRMSSGGTSASH
WPWFKKMEEIVGNSMTTKGASDEDRSGSSLGNAAKPARRYPLVTYNPGVQINNVKSKATSNPRWRRVVLKISGAALACTG
PNNIDPKIVGLIAREVAMACRLGVEVAIVVGSRNLFCGGTWITATGLDRTTAYHISMMASVMNSVLLQSSLEKMGVQARL
QTGIAVQGVGEPYNRQRATRHLDKGRVVIFGGIGATLGNPLLSSDAAAALRAIDINAEAMVKGTNVEGVYDCHSQDSNAT
FEHITFHELASRGLTTMDTMALNFCEENSIPVVVFNFLEAGNITKALCGEQVGTLIDRTGRGVS*

DNA
ATGGCTTCCTGTGACGACGACTTCTCTCTTCTAGGAGGAGAGGACCAATCAAACCCTAACCAACATCACCACCACCACCA
CCAGGTCCTCCACCACGCGCCGTACGCTCCTCGACGATTCGCCCCGAAGCTCTCGAACCAGATCCACGCGCCACATCATC
ACCAGAGCAACGGCGACGAGGACGACGAGCACCACGACGTCGTCGCGTCCTCCGCTTTCCACGGCGTGAATCCTTTCTCG
ACCGACGAGAATTCGAATCCCTATGATAACAACAACAACAACGCGGCTGTGGAAGGAGGAGACGAGGATCTGGACGCGAA
CAGATCCAGGATCGGGGGAGGAGCTCGTCTGGAGAAGAGGCAGAGTCAGGAGGAGCTCAGCGACGGCGGAACGACGAACG
GCGGGGATACGACTCCGTACGGTAGCTTCAAACGGCCGAGGACGTCGTCTTCCTCCGCCGGGGAGTACAGGAAGGATAGA
GAGGAGTGGAGCGACGCGGCGATCACGTGTTTGTTGGATGCGTACTCTGACAAGTTCACTCAGCTCAACAGAGGGAATCT
CCGGGGGAGGGATTGGGAAGACGTTGCTGCGACGGTGAGCGAGAGGTGTGAGAAGCTGATCAAGAGTGTGGAGCAGTGTA
AGAACAAGATTGATAATCTCAAGAAGAGGTATAAGCTAGAGAGGCATAGGATGAGTAGCGGCGGAACGTCTGCTAGCCAT
TGGCCTTGGTTCAAGAAGATGGAAGAGATTGTTGGTAACTCTATGACCACGAAAGGTGCGTCTGATGAGGATAGAAGTGG
CAGCTCGCTGGGGAATGCTGCGAAGCCAGCGAGGAGGTATCCCTTGGTGACGTATAACCCTGGAGTTCAGATTAATAACG
TTAAGTCTAAGGCTACATCAAACCCTAGATGGCGAAGAGTGGTTTTGAAAATCAGTGGTGCAGCTCTCGCCTGCACGGGT
CCTAATAACATTGATCCGAAGATCGTTGGTCTGATTGCTAGAGAGGTTGCAATGGCTTGTCGTCTTGGTGTAGAGGTAGC
AATAGTTGTTGGGAGTCGGAACTTATTTTGCGGTGGTACATGGATTACTGCTACTGGTTTGGATAGAACCACTGCATATC
ATATCAGTATGATGGCGTCTGTGATGAATTCTGTTTTACTTCAATCATCCCTGGAGAAAATGGGAGTTCAGGCACGGTTA
CAAACTGGAATTGCGGTTCAAGGGGTCGGGGAGCCGTACAATCGTCAACGAGCCACTCGACATCTTGATAAAGGCAGAGT
GGTAATATTTGGTGGCATTGGTGCAACGCTTGGCAATCCACTTTTATCATCCGATGCAGCTGCAGCTCTTCGAGCTATAG
ATATTAATGCAGAGGCAATGGTGAAAGGAACAAACGTGGAAGGTGTTTATGACTGCCATTCACAAGATAGTAACGCCACA
TTCGAGCACATAACATTTCACGAGTTGGCTTCTAGAGGTCTTACGACAATGGACACTATGGCCCTTAACTTCTGTGAAGA
GAATAGCATTCCAGTTGTGGTGTTTAACTTTCTGGAAGCTGGGAACATCACAAAGGCATTGTGCGGAGAACAAGTGGGCA
CTTTGATCGACAGGACCGGGAGGGGTGTGAGTTAG