Details for Chinese cabbage Locus Brara.E03044

Position : A05 ( 5`- 25344443 .. 25346187 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03044

Protein [Map View]
MESNVMFTGFSPTMLSLETPQNPPNPVQFQHPHPHPYTAASDQQTHQQPMKPLYPYAAKAKQLSPISVGGGGGGGEEDDR
GSGSGSGCHPEDSAGTTDGKRKISPWHRMKWTDTMVRLLIMAVFYIGDEAGGALGGDQTDAKKKIITGGMMLQKKGKWKS
VSRAMVEKGFSVSPQQCEDKFNDLNKRYKRVNDILGRGTACHVVENQGLLEGMDHLTPKLREEVKKLLNSKHLFFKEMCA
YHNSCGHLDQPGLPNQIPVQSKPDFQMARIVEREEEEEEEESDMAEDSETEIEDTDEEEETSKKRRVSAAVKRMREETAR
VLDDPGKSAWEKKEWMRRKALEIEERKVGYEWEAVEMEKQRVKWVRYRSKKEREMEKAKLENQRRSLETERLVLVLRRRE
IELTELQLAGKRVDPSSATG*

DNA
ATGGAATCTAATGTAATGTTTACTGGGTTTAGTCCCACAATGCTAAGCCTCGAGACTCCCCAGAATCCTCCAAACCCCGT
GCAGTTTCAGCATCCTCATCCTCATCCTTACACAGCCGCAAGCGATCAGCAAACTCATCAACAACCGATGAAACCGTTAT
ACCCTTACGCAGCCAAGGCCAAACAGCTCTCACCAATAAGCGTCGGCGGAGGAGGAGGAGGAGGAGAAGAAGACGACCGC
GGGTCAGGCTCCGGATCCGGGTGCCACCCGGAAGACAGCGCGGGAACCACCGACGGAAAACGAAAAATCTCTCCGTGGCA
CCGGATGAAATGGACGGACACGATGGTCCGGCTCCTGATCATGGCGGTATTCTACATCGGCGACGAGGCCGGTGGTGCGT
TGGGAGGGGATCAAACCGACGCGAAGAAGAAGATCATCACTGGGGGGATGATGCTGCAGAAGAAAGGGAAGTGGAAGTCC
GTGTCGAGAGCCATGGTGGAGAAAGGCTTCTCCGTGTCTCCGCAGCAGTGCGAGGACAAGTTCAACGACTTGAATAAAAG
GTATAAAAGAGTCAACGATATTCTCGGGAGAGGGACCGCGTGCCACGTGGTGGAGAATCAGGGGTTGTTAGAGGGGATGG
ATCATCTCACGCCTAAGTTGAGAGAGGAGGTTAAGAAGCTGCTTAACTCTAAGCATTTGTTTTTTAAGGAGATGTGCGCT
TATCATAATAGCTGCGGGCATTTAGACCAACCGGGATTACCGAATCAAATCCCGGTTCAGTCTAAACCGGATTTTCAAAT
GGCGAGGATTGTGGAGAGAGAGGAGGAGGAGGAGGAGGAGGAGTCTGATATGGCGGAGGATTCGGAGACGGAGATTGAGG
ATACTGATGAGGAGGAGGAGACGAGTAAGAAGCGGAGGGTGTCCGCGGCTGTGAAGAGGATGAGAGAGGAGACGGCGCGC
GTGTTGGATGATCCCGGGAAGAGCGCGTGGGAGAAGAAGGAGTGGATGAGGAGGAAGGCGTTGGAGATTGAGGAGAGGAA
GGTCGGGTACGAGTGGGAGGCGGTGGAGATGGAGAAGCAGAGGGTGAAGTGGGTAAGGTATAGGAGCAAGAAGGAGAGGG
AGATGGAGAAGGCGAAGCTGGAGAATCAGCGGAGGAGTCTTGAGACGGAGAGGTTGGTTCTGGTTCTGAGGCGGAGGGAG
ATTGAGCTTACGGAGTTGCAGTTGGCGGGTAAACGGGTTGACCCGAGTTCGGCAACCGGGTGA