Details for Chinese cabbage Locus Brara.E03040

Position : A05 ( 5`- 25332421 .. 25332918 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03040

Protein [Map View]
MGNCIVMEKKVIKIMRNDGEVVEYRGPMKVHDILTQFSGHYSLFDSLSNHCHLHPQAKLLCGRLYYLMPRQTTTVKHKKT
KKVRFANPEVEKEGDTKEKSPSVVRVKMVVSKKELEKLLQGGSVHEVVYRSLDKQHLCRDDDGAASAEECLTGWRPLLDS
IPESV*

DNA
ATGGGGAATTGTATAGTAATGGAGAAGAAAGTGATAAAGATAATGAGAAATGATGGAGAAGTAGTTGAATACAGAGGACC
CATGAAGGTTCATGACATCCTCACCCAATTCTCTGGTCACTACTCTCTCTTTGATTCTCTGTCAAACCATTGTCATCTTC
ATCCACAAGCCAAGCTTCTCTGCGGTCGTCTCTACTATCTCATGCCGAGGCAGACGACCACAGTAAAGCACAAGAAAACG
AAGAAAGTCAGGTTTGCAAATCCAGAGGTTGAAAAAGAAGGAGATACTAAGGAGAAGAGTCCTAGTGTCGTGAGAGTGAA
GATGGTTGTGAGTAAGAAAGAGCTAGAGAAGCTGCTTCAAGGAGGTTCAGTTCATGAAGTGGTCTATAGGAGTCTTGATA
AGCAACATCTATGTCGTGATGATGATGGTGCAGCTTCTGCTGAAGAGTGTCTTACAGGCTGGAGACCTTTGTTAGATAGC
ATTCCAGAATCTGTGTAG