Details for Chinese cabbage Locus Brara.E03036

Position : A05 ( 5`- 25320430 .. 25321056 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03036

Protein [Map View]
MKFAKLNPKRLFRSKDRSTVSKSTASSFSSGAADECNNHSPAVTGGSVTPTSILPEVSAVHSPYSYVEILQAFKLIDRDN
DGAVSRHDLESLLTRLGPDPPTEEEIDVMLKEVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRDGKISA
EELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFTEFSRMMDLQR*

DNA
ATGAAATTCGCAAAACTGAATCCAAAACGTTTGTTCAGATCCAAAGACCGTTCAACGGTCTCTAAATCCACCGCTTCCTC
TTTCTCCTCCGGCGCCGCGGACGAGTGTAATAATCACTCCCCCGCCGTCACCGGAGGCTCCGTCACTCCCACCAGCATCC
TCCCGGAGGTCTCAGCCGTTCATTCTCCCTACTCGTACGTCGAGATCCTCCAGGCGTTCAAGCTCATCGACAGAGACAAC
GACGGAGCCGTCTCGAGGCACGACCTCGAGTCGCTCCTCACGCGCCTCGGTCCCGATCCTCCGACGGAGGAGGAGATCGA
CGTCATGCTCAAGGAGGTGGACTGCGACGGAGACGGTACGGTTCGCCTGGAAGAGCTCGCCAGCCGCTGCGTCGATGATG
ATCAGTCTCGCGGTGGCTCGGACGAGCTGAAGGAGACGTTCGAGTTCTTCGACGCGGATCGCGACGGTAAGATCTCGGCG
GAGGAGCTTCTCCGAGTTTTCTCGGCTATTGGAGACGAGCGGTGCACGTTAGAGGAGTGCGAGCGTATGATAGCGGCCGT
TGACGATGACGGTAACGGATTCGTGTGCTTCACTGAGTTCTCGAGAATGATGGATCTCCAGCGATGA