Details for Chinese cabbage Locus Brara.E03031

Position : A05 ( 5`- 25287354 .. 25289109 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03031

Protein [Map View]
MATSRLQMEGDDSVLLHVTHSNLKSFAADVRFSPQMNVEAVKEKLWKKCGTSVNAMALELYDESGSKVAVLSDDTRPLGF
YSPFDGFRLHIVDLDPSSVTTGGWLEDTSLVEKYTISEEDYAKRTDSYRKFKEKRVAQNPAASEVKTKEEDFMEDLCGNI
KVGDRCQVEPGEKRGVVKYVGRAESLGPGYWVGIQYDEPLGKHDGMVKGTRLFECPQLHGGVVRPDKVKVGDYPERDPFE
EDEI*

DNA
ATGGCGACTTCGCGGTTACAGATGGAAGGAGATGACTCTGTACTTCTCCACGTAACTCACTCCAACCTCAAGAGCTTCGC
TGCCGATGTTCGTTTCTCTCCGCAAATGAATGTGGAAGCTGTGAAGGAAAAGCTATGGAAAAAATGTGGGACATCTGTAA
ATGCTATGGCTTTAGAGCTTTATGATGAAAGTGGCTCCAAGGTTGCAGTCCTTAGTGATGATACGAGACCACTCGGTTTC
TACTCCCCTTTTGATGGGTTTCGGTTACACATAGTTGATCTTGACCCTTCCTCGGTCACAACTGGAGGCTGGCTTGAAGA
TACTTCATTGGTTGAGAAGTATACTATCTCAGAAGAGGACTATGCTAAACGAACTGACAGTTATAGGAAATTCAAAGAAA
AAAGAGTGGCTCAGAATCCTGCTGCTTCTGAGGTTAAGACGAAGGAGGAGGACTTCATGGAAGATCTCTGTGGAAATATC
AAGGTGGGAGATAGATGCCAAGTTGAGCCAGGGGAGAAAAGAGGAGTGGTCAAGTACGTTGGACGAGCAGAGTCGTTGGG
TCCTGGCTATTGGGTTGGAATCCAGTATGATGAACCCCTTGGCAAACACGATGGCATGGTGAAAGGAACAAGGTTATTTG
AATGCCCTCAGCTTCATGGTGGTGTGGTCCGGCCTGACAAAGTAAAGGTTGGTGATTATCCAGAAAGGGACCCCTTCGAG
GAAGATGAAATATAA