Details for Chinese cabbage Locus Brara.E03030

Position : A05 ( 5`- 25285522 .. 25287498 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03030

Protein [Map View]
MDTLLRTPNKLEFFIPQFHGFERLSPNPSRVKLGLKKRAIRIGSSITSASSALLDLVPETKKENLDFDLPLYDTSLNKTV
DLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYINDGAEKDLSRPYG
RVNRKQLKSKMLQKCITNGVRFHQAKVTDVVHEEVNSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIV
AEVDGHPFDVDKMVFMDWRDKHLDAYPEVKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLKMEDIQERMVARLKHLG
INVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSTKGDELSAEVWRDLW
PIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNTSRLEIMTKGTVP
LAKMINNLVKDRD*

DNA
ATGGATACTCTCTTGAGAACACCCAACAAGCTCGAGTTTTTCATCCCTCAGTTTCATGGGTTCGAGAGATTAAGTCCAAA
TCCTTCAAGGGTTAAGCTTGGTTTGAAGAAAAGAGCAATCAGAATCGGTAGTAGTATCACTAGTGCTAGTAGTGCTCTTT
TGGATCTTGTTCCTGAAACCAAGAAGGAGAATCTCGACTTCGACCTTCCTTTATACGACACTTCCCTGAACAAAACTGTT
GATCTAGCTATCGTCGGCGGCGGCCCTGCTGGTTTAGCCGTGGCTCAACAAGTCTCAGAAGCTGGACTCTCTGTATGCTC
CATCGACCCTTCCCCCAAACTCATTTGGCCTAACAACTATGGAGTTTGGGTTGACGAGTTCGAAGCCATGGACTTGCTAG
ACTGCCTAGACACCACCTGGTCCGGCGCCGTCGTCTACATCAACGACGGCGCCGAGAAGGACCTATCCCGGCCTTACGGG
AGAGTCAACCGTAAACAGCTCAAATCCAAGATGCTTCAGAAGTGCATCACCAACGGTGTTAGGTTCCATCAGGCTAAGGT
GACCGACGTGGTTCACGAGGAGGTGAACTCCACTGTTGTCTGCAGTGACGGTGTGAAGATTCAGGCTTCTGTTGTTCTCG
ACGCTACTGGTTTTTCAAGATGCTTGGTGCAGTACGACAAGCCGTATAACCCGGGGTATCAAGTAGCTTATGGTATCGTT
GCTGAGGTCGATGGCCACCCGTTTGATGTGGATAAGATGGTGTTTATGGACTGGAGAGATAAGCATCTTGACGCGTACCC
TGAGGTTAAAGAACGGAACAGCAAGATCCCTACGTTCTTGTACGCGATGCCGTTTTCTTCAAACAGAATCTTTCTTGAGG
AGACGTCTCTTGTGGCTAGGCCGGGTTTGAAGATGGAAGATATCCAAGAGAGGATGGTTGCGAGGCTGAAACATTTGGGG
ATCAATGTGAAGCGTATTGAGGAAGACGAGCGTTGTGTGATCCCTATGGGAGGTCCTTTACCTGTCTTGCCTCAAAGAGT
TGTTGGCATTGGCGGTACGGCGGGGATGGTTCATCCTTCCACCGGTTACATGGTGGCTAGGACTCTTGCAGCTGCTCCAA
TAGTTGCAAACGCTATAGTGAGGTACCTTGGTTCTACTAAAGGAGATGAGCTCTCGGCTGAGGTGTGGAGAGACTTGTGG
CCTATTGAAAGGCGGAGACAGAGGGAGTTCTTCTGTTTTGGGATGGATATATTGCTGAAGCTTGATTTGGATGCTACTAG
GAGGTTCTTTGATGCGTTCTTTGACCTGGAACCGCGCTACTGGCATGGTTTCTTGTCGTCGAGGCTGTTTCTCCCGGACT
TAGTGTTCTTCGGGTTGTCGCTCTTCTCGCATGCTTCGAATACCTCGAGGTTGGAGATCATGACTAAGGGAACTGTTCCT
CTTGCTAAGATGATCAACAATTTGGTAAAAGATAGAGACTAA