Details for Chinese cabbage Locus Brara.E03029

Position : A05 ( 5`- 25281947 .. 25284924 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03029

Protein [Map View]
MSSGTVRRVSRQDIQLVQNLIERCLQLYMNQKEVVETLLEQAKIEPGFTELVWQKLEEENREFFNAYYLRLMVKHQIMEF
NKLLEQQVRHMQQMHPSGLTSVQNTNGSHIQSMNQKQLGYASEHTDHQSLKPNAHHPMPSSLSNAYLNGSSTLNTNVSPS
VNVSTHARRVDASPNMISSQQTTNMPPMMQGMNGGGGGMIKSETAYPASFMYGGERNNALEGHSTVRETSIPSFSSESNN
NQPIGDTLLDAEASTFGFLGSIPRNFSLSDLTADFSQSSEILESYDKSPFLAPDAENFLDSCDRGEYQGDNKRLDTISEG
FSYDNLGSE*

DNA
ATGTCAAGTGGAACAGTGAGAAGGGTCTCGCGTCAAGACATACAACTGGTTCAAAACCTTATAGAACGATGCCTTCAACT
TTACATGAACCAGAAAGAAGTTGTGGAAACTTTACTGGAGCAGGCTAAAATCGAGCCTGGGTTCACAGAGCTAGTGTGGC
AGAAGCTTGAAGAAGAGAACCGTGAATTTTTCAACGCGTACTATCTGAGGCTCATGGTGAAACACCAGATCATGGAATTC
AACAAGCTACTTGAGCAGCAGGTTCGCCATATGCAGCAGATGCATCCAAGTGGACTTACCTCCGTCCAGAATACAAATGG
TTCTCACATCCAATCAATGAATCAGAAACAGTTGGGATATGCCTCTGAACACACTGATCATCAATCATTGAAGCCTAATG
CACATCATCCCATGCCCTCGAGTTTGTCTAACGCATACCTCAACGGCTCTTCAACGCTTAACACAAACGTGTCCCCTTCT
GTGAACGTATCAACCCACGCTAGGAGAGTTGACGCTTCTCCGAATATGATCTCATCACAACAGACCACAAACATGCCGCC
TATGATGCAAGGCATGAATGGAGGAGGAGGAGGGATGATCAAGTCCGAGACTGCCTATCCTGCTTCGTTCATGTATGGTG
GTGAACGGAACAATGCCTTGGAAGGACACTCCACAGTTAGAGAAACCTCGATTCCATCTTTCAGTAGCGAGTCCAACAAC
AACCAGCCCATTGGTGATACGCTACTTGATGCGGAAGCTTCTACTTTTGGGTTCTTAGGATCAATTCCTAGGAACTTCAG
CCTTTCTGATTTGACTGCTGATTTTTCACAGAGCTCAGAGATTCTGGAGAGCTATGATAAATCACCCTTCCTTGCGCCAG
ATGCTGAAAATTTCCTGGACTCCTGCGACAGGGGAGAGTATCAAGGAGACAACAAGAGGTTGGATACCATATCTGAAGGT
TTCAGTTACGACAACCTCGGGAGCGAGTAG