Details for Chinese cabbage Locus Brara.E03027

Position : A05 ( 5`- 25272898 .. 25279326 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03027

Protein [Map View]
MALLQRPPSYLHLYFRLMASSRPRLFSHSLCPSLHRHSSSLSSSTPRIKFQLAKVLSQRLVLRNAVSPRSFMSSTMDTDS
LHESSTSKDYSSEHIQVLEGLDPVRKRPGMYIGSTGSRGLHHLVYEILDNAIDEAQAGFASKIDVVLHADGSVSISDDGR
GIPTDLHPATRKSSLETVLTVLHAGGKFGGKSSGYSVSGGLHGVGLSVVNALSEALEVIVRRDGMEFQHKYSRGKPITTL
TCHVLPPESRGTQGTCIRFWPDKEVFTTAIQFDHNTIAGRIRELAFLNPKVTISLKKEDDDPERDLYSEYFYAGGLTEYV
SWLNTDKKPLHDVLGFRKEINGTTVDVALQWCSDAYSDTMLGYANSIRTIDGGTHIEGVKASLTRTLNSLAKKLKVIKEK
DISLSGEHVREGLTCIVSVKVPDPEFEGQTKTRLGNPEVRKIVDQSLQEYLTEYLELHPDVLESIISKSLNAYKAALAAK
RARELVRSKSILKSSSLPGKLADCSSTDPAVSEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIERKDEAAMYKNEE
IQNLILGLGLGVKGEDFNMENLRYHKIIILTDADVDGAHIRTLLLTFFFRYQRALFDAGCIYVGVPPLFKVERGKQAHYC
YDEAALKQVIASFPGNASYNIQRFKGLGEMMPEQLWETTMNPDTRILKQLVVDDAAETNVVFSSLMGARVDVRKELIKSA
ATRINVEHLDI*

DNA
ATGGCTCTTCTTCAGAGGCCACCCTCTTATCTTCACCTCTATTTTCGCCTCATGGCTTCTTCTCGTCCCCGTCTCTTCTC
CCACTCCCTATGCCCCTCACTTCACCGTCACTCCTCCTCGCTCTCCTCTTCAACACCCAGGATAAAGTTCCAGTTAGCTA
AGGTTTTGAGTCAAAGACTTGTACTAAGAAATGCGGTCTCACCAAGGTCCTTTATGTCATCCACCATGGACACTGATTCT
CTCCATGAGAGCTCCACCTCTAAGGATTACAGTTCCGAGCACATTCAAGTGCTGGAAGGTTTAGACCCTGTCAGGAAAAG
ACCTGGGATGTATATTGGGAGCACTGGATCTCGTGGTTTGCATCATCTGGTTTATGAGATACTTGACAACGCAATTGACG
AGGCACAAGCTGGTTTTGCTTCAAAGATTGACGTTGTTTTACATGCAGATGGTTCAGTCAGCATTTCTGATGATGGACGT
GGGATACCTACGGACTTGCATCCCGCAACGAGAAAATCTTCTTTGGAGACTGTCCTCACGGTCTTACACGCAGGGGGTAA
GTTTGGTGGCAAGAGTAGTGGGTACAGCGTGTCTGGTGGATTGCATGGTGTAGGTTTATCGGTTGTGAATGCTTTATCAG
AGGCATTGGAGGTTATTGTTCGCAGAGATGGGATGGAGTTCCAGCATAAGTACTCTCGTGGAAAGCCCATAACAACACTT
ACTTGTCATGTCCTCCCACCAGAGTCAAGGGGTACTCAAGGGACATGCATCAGGTTTTGGCCTGACAAAGAAGTATTCAC
AACTGCAATTCAGTTTGACCATAACACTATTGCTGGAAGAATTAGGGAGCTTGCTTTCCTAAATCCAAAGGTTACAATCT
CTCTGAAAAAGGAGGATGATGATCCAGAAAGGGACCTGTATAGTGAATATTTTTATGCTGGAGGTTTAACTGAGTATGTT
AGCTGGCTAAATACCGATAAGAAACCGCTCCATGATGTGCTGGGTTTCCGGAAAGAGATAAATGGCACCACCGTTGACGT
TGCACTTCAGTGGTGCTCTGATGCGTATTCAGACACGATGCTGGGATACGCGAATAGTATTCGCACCATTGATGGTGGGA
CACATATTGAAGGTGTGAAGGCTTCGTTAACAAGAACTCTAAATAGCCTCGCAAAAAAATTAAAGGTTATCAAGGAGAAG
GATATTAGCTTAAGTGGGGAACATGTTAGAGAGGGATTGACCTGCATTGTCTCAGTCAAGGTTCCTGATCCCGAGTTTGA
AGGTCAAACAAAGACGAGACTAGGGAATCCAGAGGTGAGAAAAATTGTTGACCAATCACTCCAGGAGTACCTCACGGAGT
ACTTGGAATTGCATCCAGATGTTCTTGAAAGCATTATTTCCAAATCCTTGAATGCGTACAAGGCTGCCCTGGCTGCCAAG
AGAGCTAGGGAGTTGGTCAGATCAAAAAGCATTTTGAAGTCATCCTCACTTCCTGGGAAACTGGCAGATTGCTCATCTAC
AGATCCTGCAGTATCTGAGATTTTTATAGTCGAAGGAGATTCAGCTGGTGGCAGCGCAAAACAGGGTCGTGACAGGCGTT
TCCAAGCGATTCTTCCTTTAAGAGGTAAAATTTTGAATATTGAGAGAAAGGATGAAGCAGCCATGTATAAGAACGAAGAA
ATTCAAAATCTAATTCTTGGTCTTGGTCTTGGAGTGAAGGGAGAAGATTTTAACATGGAGAATTTGCGTTACCATAAAAT
CATCATATTAACAGATGCAGATGTTGATGGTGCACATATCCGGACACTTCTCTTGACCTTTTTCTTCAGATATCAGAGAG
CCTTGTTTGACGCTGGTTGCATATACGTTGGTGTTCCACCTCTTTTCAAGGTTGAGAGGGGGAAACAGGCGCACTATTGC
TATGATGAGGCAGCTCTTAAACAAGTTATCGCTTCGTTCCCTGGAAATGCATCCTACAACATCCAGAGGTTCAAAGGTTT
GGGTGAGATGATGCCTGAGCAGCTATGGGAAACAACAATGAATCCAGATACAAGGATACTGAAGCAACTAGTTGTTGATG
ACGCAGCAGAAACAAATGTGGTCTTCTCATCTCTCATGGGTGCTAGGGTCGATGTCCGGAAGGAACTCATCAAAAGCGCT
GCGACTAGAATCAATGTAGAGCATCTTGACATATGA