Details for Chinese cabbage Locus Brara.E03026

Position : A05 ( 5`- 25269352 .. 25271106 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03026

Protein [Map View]
MNNNKKNRDQKPEMSSSSSSSSSPKKQTLFISSLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYLSI
VFLKLVPLQHLKSRSQFMKVATLSVVFCASVVGGNVSLRYLPVSFNQAVGATTPFFTALFAYLMTFKREAWVTYGALVPV
VTGVVIASGGEPGFHWFGFIMCISATAARAFKSVLQGILLSSEGEKLNSMNLMLYMSPIAVIALLPVTIVMEPDVMSVTL
SLARQHKYMWVLLLVNSIMAYSANLLNFLVTKHTSALTLQVLGNAKGAVAVVISILLFRNPVTVMGIGGYSITVLGVVAY
GETKRRFR*

DNA
ATGAACAACAACAAGAAGAACCGAGATCAAAAACCAGAAATGTCCTCATCGTCTTCTTCTTCATCTTCTCCCAAGAAACA
AACCCTCTTCATATCATCCCTAATCATCCTATGGTACACCTCCAACATCGGCGTCCTTCTCCTCAACAAGTTCCTCCTCT
CCAACTACGGATTCAAATTCCCCATCTTCCTCACGATGTGCCACATGTCAGCATGCGCCATCCTCAGCTACCTTTCCATC
GTCTTCCTCAAGCTCGTCCCTCTCCAGCACCTCAAATCTCGCTCTCAGTTCATGAAAGTCGCCACTCTCAGCGTCGTCTT
CTGCGCCTCCGTTGTTGGAGGAAACGTCTCCCTTCGTTATCTTCCTGTTTCGTTTAATCAAGCCGTGGGGGCTACGACGC
CGTTTTTCACCGCGTTGTTTGCGTATCTCATGACGTTTAAGAGAGAGGCTTGGGTTACGTATGGTGCTCTCGTCCCTGTT
GTTACCGGTGTCGTGATCGCTAGTGGGGGTGAGCCAGGTTTTCACTGGTTTGGATTCATTATGTGCATCAGTGCTACTGC
TGCAAGAGCTTTTAAATCAGTTCTTCAAGGCATCCTACTTTCTTCCGAAGGAGAAAAGTTGAACTCGATGAATTTGATGT
TGTACATGTCCCCTATAGCCGTCATTGCGCTTCTACCCGTCACAATAGTAATGGAACCAGATGTGATGAGTGTGACACTA
TCACTCGCAAGACAACATAAGTACATGTGGGTACTTCTCTTGGTTAACTCTATAATGGCTTATTCAGCCAACTTGTTGAA
CTTTCTTGTCACCAAGCACACCAGCGCACTTACCCTCCAGGTTCTTGGAAACGCCAAAGGAGCGGTTGCGGTTGTGATCT
CGATCTTGCTTTTCAGAAACCCGGTCACGGTGATGGGAATTGGTGGGTATAGTATAACGGTGCTTGGGGTTGTTGCTTAT
GGAGAGACTAAACGTAGGTTTAGATGA