Details for Chinese cabbage Locus Brara.E03023

Position : A05 ( 5`- 25247650 .. 25251410 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03023

Protein [Map View]
MDLCKQNNNHIVAVSADPLNWNAAAEALKGSHLEEVKRMVEDYRKGAVRLGGETLTIGQVAAVASGGVTVELAEEARAGV
KASSDWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGAGVGDTSLTLPKSATRAAMLVRVNTLLQ
GYSGIRFEILEAITKLLNNEITPCIPLRGSITASGDLVPLSYIAGLLTGRPNSKAVGPAGETLTASDAFKLAGVPSFFEL
QPKEGLALVNGTGVGSGLASMVLFETNVLAVLSEVMSAMFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILHGSSY
VKEAQQLHELDPLQKPKQDRYALRTSPQWLGPQIEVIRAATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVAMD
NTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDV
NSLGLISSRKTEEAVEILKLMSTTYLVALCQAVDLRHIEENLKKAVKAAVSQVAKRVLTVGVNGELHPSRFTERDVLQVV
DREHVFSYADDPCSFAYPLMQKLRHVLVDHALEDPEREADASTSVFQKIGAFEAELKVVLPKEVERVRGEYEGGCSVIGN
RIKECRSYPLYRFVREELETELLSGESVRSPGEEFDKVFSAICDGKVIDPLLECLKEWNGAPVPIC*

DNA
ATGGACTTGTGCAAACAAAACAACAACCACATCGTCGCTGTTTCCGCCGATCCGTTGAACTGGAACGCGGCGGCGGAAGC
TTTGAAAGGGAGCCACTTGGAGGAGGTGAAACGTATGGTGGAAGATTACAGAAAAGGTGCGGTGCGGTTAGGAGGAGAGA
CGCTGACGATTGGTCAAGTTGCAGCCGTGGCTAGCGGAGGAGTGACGGTGGAGCTGGCGGAGGAGGCTCGTGCCGGAGTT
AAGGCGAGTAGCGACTGGGTGATGGAGAGCATGAACCGTGGCACGGACAGTTATGGAGTCACCACAGGGTTTGGTGCAAC
GTCCCATAGAAGAACTAAACAAGGCGGTGCACTTCAAAAGGAGCTTATTAGGTTCTTGAACGCCGGAATATTCGGTGCCG
GCGTCGGAGACACGTCACTCACGCTACCTAAGTCGGCAACTAGAGCAGCTATGCTCGTCCGTGTCAACACTCTCCTCCAA
GGCTACTCTGGAATACGCTTTGAGATTCTTGAAGCCATTACAAAGCTTCTTAACAACGAAATCACTCCATGCATCCCTCT
CCGTGGCAGCATCACCGCATCCGGCGACCTTGTTCCTCTCTCTTACATCGCCGGACTGCTCACCGGCCGTCCCAATTCAA
AAGCCGTGGGTCCCGCCGGTGAGACTCTCACTGCCTCCGATGCCTTTAAGCTAGCCGGAGTACCGTCCTTTTTTGAGCTG
CAGCCAAAGGAAGGACTGGCTCTTGTGAACGGGACAGGGGTCGGATCGGGTCTGGCTTCGATGGTTCTGTTTGAGACCAA
TGTTTTGGCGGTTTTGTCTGAAGTTATGTCTGCGATGTTCGCGGAGGTCATGCAAGGGAAGCCGGAGTTTACTGATCATC
TAACGCATAAGCTCAAGCACCATCCTGGTCAGATTGAAGCCGCTGCGATTATGGAACATATATTACATGGAAGCTCTTAC
GTTAAAGAAGCTCAGCAGCTTCATGAACTGGATCCGCTTCAAAAACCTAAACAAGATCGGTACGCGCTAAGGACGTCACC
ACAATGGCTAGGACCACAAATCGAAGTGATCAGAGCAGCGACCAAGATGATAGAGCGCGAGATCAACTCGGTCAACGACA
ACCCTCTCATCGACGTCTCCAGAAACAAAGCACTACACGGCGGTAACTTCCAAGGCACGCCTATCGGTGTCGCCATGGAC
AACACCCGCTTAGCCATCGCTTCCATCGGCAAACTCATGTTCGCGCAGTTCTCCGAGCTCGTGAACGACTTCTACAACAA
CGGCTTGCCTTCAAACCTATCCGGCGGGAGAAACCCTAGTCTCGACTACGGTTTCAAAGGCGCGGAGATCGCCATGGCTT
CTTACTGCTCGGAGCTCCAGTTCTTGGCTAACCCCGTGACCAACCACGTCCAGAGCGCCGAGCAGCATAACCAAGACGTT
AACTCGCTAGGGCTGATCTCGAGTAGGAAGACAGAAGAAGCTGTTGAGATCCTCAAGCTGATGTCCACTACCTACTTGGT
TGCCTTATGCCAAGCCGTTGATCTGCGTCATATCGAAGAGAATCTCAAGAAAGCTGTTAAAGCCGCGGTGAGCCAGGTGG
CGAAACGGGTGTTAACGGTTGGTGTTAACGGCGAGCTGCATCCGTCGAGGTTCACGGAGCGTGATGTGCTCCAAGTGGTT
GATAGAGAGCACGTGTTCTCATACGCGGACGATCCTTGCAGCTTTGCTTATCCGTTGATGCAGAAGCTTAGGCACGTTCT
TGTGGACCACGCTTTAGAGGATCCGGAGCGTGAGGCTGATGCTTCGACGTCGGTTTTTCAGAAGATAGGAGCGTTTGAGG
CGGAGCTGAAGGTGGTTTTACCTAAGGAGGTGGAGCGTGTTAGGGGTGAGTATGAGGGAGGGTGTTCGGTTATAGGTAAC
CGGATTAAGGAATGTCGGTCTTATCCGTTGTACCGGTTTGTGAGGGAGGAGCTGGAGACTGAGCTGTTGAGTGGAGAGAG
TGTTAGGTCGCCGGGTGAGGAGTTTGATAAAGTGTTCTCGGCGATTTGTGATGGGAAGGTTATTGATCCTTTGTTGGAGT
GTCTCAAGGAGTGGAACGGAGCTCCGGTTCCGATCTGTTGA