Details for Chinese cabbage Locus Brara.E03022

Position : A05 ( 5`- 25244417 .. 25246768 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03022

Protein [Map View]
MVTLSSSLLSSSPPLCKPRVSPTTLVSRTDFISFSPRTTLSSSTISPPTLYLPVKQNRHRNSLQVKSVASPTETVSEFDE
MVSGTKRKYYMLGGKGGVGKTSCAASLAVRFANNGHPTLVVSTDPAHSLSDSFAQDLTGGMLVPVEGPDSPLFALEINPE
KAREEFRSASQMNGGTEVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKVIQFLESPEYNMFTRIVFDTAP
TGHTLRLLSLPDFLDASIGKILKLRQKITSATSAIKSVFGKEDNQPDAAEKLKRLRERMVKVRELFRDTESTEFVIVTIP
TVMAVSESSRLSASLKKESVPVKRLVVNQILPPSSSDCKFCSIKRKDQMRALDMIREDSELSGLTLMEAPLVDMEIRGVP
ALRFLGDIIWK*

DNA
ATGGTGACCCTTTCGTCCTCTCTACTATCTTCTTCTCCTCCACTATGCAAACCAAGAGTCTCGCCAACAACTCTCGTATC
TAGAACTGATTTCATCTCTTTCTCTCCTCGAACAACTCTCTCTTCATCCACAATCTCGCCACCGACTCTTTATCTCCCGG
TTAAACAGAATCGCCATAGAAACTCGCTCCAAGTGAAATCAGTAGCTAGCCCAACGGAGACGGTGTCGGAGTTCGACGAG
ATGGTCTCCGGCACGAAACGGAAGTACTACATGCTCGGAGGGAAAGGAGGAGTGGGCAAAACCAGCTGCGCTGCTTCTTT
AGCTGTGAGGTTCGCCAACAATGGACACCCAACACTTGTCGTATCCACAGATCCAGCTCACTCCCTTAGCGATTCCTTTG
CTCAGGACTTGACTGGTGGAATGCTTGTACCTGTTGAAGGACCTGACTCTCCTCTCTTTGCTCTAGAAATAAACCCTGAG
AAGGCTAGAGAAGAGTTTCGTAGTGCCTCCCAGATGAATGGAGGCACTGAGGTTAAAGATTTTATGGATGGTATGGGACT
TGGGATGCTTGTTGAACAGTTGGGGGAACTTAAACTTGGGGAATTACTAGACACACCGCCTCCTGGATTGGATGAAGCCA
TTGCCATTTCTAAGGTTATTCAATTCTTGGAATCACCAGAGTATAACATGTTCACTAGGATAGTGTTTGATACTGCACCA
ACGGGTCATACACTGAGGCTACTCTCCTTACCAGACTTCTTGGACGCGTCCATAGGTAAAATCCTGAAGCTTAGGCAGAA
AATAACCTCAGCTACTTCAGCAATCAAGTCGGTGTTTGGGAAAGAAGATAACCAGCCTGATGCGGCTGAGAAATTGAAAC
GACTAAGAGAAAGGATGGTTAAAGTTCGTGAGCTTTTTCGTGACACAGAGTCAACAGAGTTCGTCATTGTCACTATCCCA
ACGGTAATGGCTGTGAGTGAGTCTTCTAGATTAAGTGCTTCCTTGAAGAAAGAAAGTGTTCCCGTCAAAAGACTTGTTGT
TAATCAGATTCTTCCGCCATCTTCCTCTGATTGCAAATTTTGTTCCATTAAGAGAAAGGACCAAATGCGCGCTCTAGATA
TGATACGAGAGGATTCAGAACTCTCTGGTTTGACATTAATGGAGGCTCCCCTGGTCGACATGGAGATCAGAGGCGTCCCT
GCTCTGCGCTTCTTGGGCGATATCATTTGGAAATGA