Details for Chinese cabbage Locus Brara.E03020

Position : A05 ( 5`- 25231459 .. 25240274 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03020

Protein [Map View]
MGIFDGLPVPSDKTYLREELARIDESWVAARFDSLPHVVHIITSKDRETDILLLREQSDVVEEVVDEVVHAYHGGFNKAI
QNYSQILRLFSESTDKIGDLKHDLAEAKKSLGTRNKQLHQLWYRSVTLRHIIALLDQIEGIAKVPSRIEKLIADKQFYAA
IQVYLQSSLMLEREGLQTVGALQDVRSELAKLRGALFFKILDDLHAHLYNRGEYSSVASSIYERDDEVPTTTAVAASRMS
SQPLSRRTRTLKGDSQFGVRGLTNGSHRTASTEEGSSFDGHDEEDSVEHDEATGDGQTIRNGTDSKLLSYQLPPWLSDSS
PDEFIEAVRKSDDPLHVKYLQTLVQCLCMLGKVAAAGAIICQRLRPTIHEIIISKIKAHMETKNLSKSACSQGDRTGAAG
LHFIKGQSEAYRLSKDKPQNGTSNSVTHLAVSPVSPLMAPGGKAQAAAKDLLDSILDTIVKIFENHVVVGELLELRASQH
DINTPKSLPTDVNWNADSEASQATGGYTISFPLTVLQSECQQLICEILRATPEAASADAAAQTAKLAKKAPKKDKRDASE
DGVTFTFRFTDATVSISNQGADLIRQGWGKRAPNSSQEGYGSAAVLPEQGMYLAASIYRPVLQFTDKITSMLPKKHSQLV
NDGLLTFTENFVKDHLLPTMFVDYRKGVQQAISSAAAFRPRAHTTTYTPTVEKGRPILQGLLAIDLLAKEVLGWAQAMPK
FATDLVKYVQTFLERTFERCRTAYMEAVLEKLSYRLIGRHDIERLMRLDAASACLPSQLGHSVSHSEAVGSEVELCELFL
SLPSIKQDNLIRDDNKLILLASLSDSLEYVADSIERLGQAVPRAASQAEGNSRDQATSPRNLASFADEYRKLATDCLKVL
RVEMQLETVFHLQEMTNREYLEDEDAEEPDDFVISLTSQITRRDEGMAPFISGEKRNYVFGGICGIAASASIKALADMRS
INLFGVQQICRNTIALEQAMAAIPYVDGDSVQQNLDRVRTYYELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPGRD
TPSDAQVRLSEILSH*

DNA
ATGGGGATTTTCGATGGTTTGCCTGTTCCCTCCGATAAAACTTACCTTAGGGAGGAGCTGGCACGAATAGATGAGAGCTG
GGTTGCTGCACGCTTTGACTCTTTGCCACATGTGGTCCATATCATTACGTCAAAAGACCGTGAAACTGACATTCTTTTAC
TAAGGGAGCAAAGTGATGTTGTCGAGGAGGTTGTGGATGAAGTTGTCCATGCTTACCATGGTGGTTTCAACAAAGCCATT
CAAAACTACTCTCAGATCTTGCGACTATTCAGCGAGTCCACTGATAAAATAGGCGACTTGAAGCATGATCTGGCAGAAGC
AAAGAAGAGCTTGGGGACACGCAATAAACAATTACACCAGTTGTGGTACCGTTCTGTGACATTGCGGCACATCATCGCGC
TTTTGGATCAGATTGAGGGCATTGCTAAGGTTCCATCTCGTATTGAGAAGCTCATTGCTGATAAGCAGTTTTACGCTGCT
ATTCAAGTGTATCTCCAGTCTTCTCTGATGCTTGAGCGTGAGGGGCTTCAAACGGTTGGTGCTCTTCAAGATGTCAGATC
TGAGCTAGCTAAGCTGCGGGGAGCCCTTTTCTTCAAAATTCTAGACGATTTGCATGCACATCTGTACAATAGAGGTGAAT
ACAGTTCAGTTGCGTCAAGCATATATGAAAGAGATGATGAAGTACCAACAACAACAGCTGTTGCAGCAAGTCGAATGAGC
TCACAACCACTCTCTCGTAGAACACGGACACTGAAAGGTGATAGTCAGTTTGGTGTTAGAGGCCTCACAAATGGTTCACA
TAGAACGGCTTCTACTGAGGAAGGTTCATCATTTGATGGACATGATGAGGAGGACTCTGTAGAACATGATGAAGCCACCG
GAGATGGACAGACTATCAGGAATGGCACTGATAGTAAATTGCTTTCTTACCAACTTCCACCTTGGCTTTCTGATTCCTCT
CCTGACGAGTTTATCGAAGCAGTAAGAAAGAGTGATGATCCACTGCATGTGAAGTATCTACAGACTCTTGTTCAGTGTCT
TTGCATGCTCGGCAAAGTTGCAGCTGCTGGTGCTATTATATGCCAAAGACTTCGACCCACGATACATGAGATCATAATAT
CCAAGATTAAGGCCCATATGGAGACTAAAAATTTGTCAAAGTCAGCCTGTAGTCAGGGTGATCGAACGGGAGCTGCTGGA
TTGCATTTTATCAAAGGACAGTCCGAGGCCTACAGATTATCAAAAGATAAACCGCAAAATGGGACATCAAATTCTGTAAC
TCACCTGGCTGTGAGCCCTGTCTCGCCTCTTATGGCTCCTGGAGGCAAAGCGCAGGCTGCAGCAAAAGATCTTCTTGACT
CAATTTTAGATACTATTGTCAAGATATTTGAAAATCATGTTGTTGTTGGAGAGCTTTTGGAGTTGAGGGCTTCGCAACAT
GACATTAACACACCGAAGTCATTGCCTACTGATGTGAATTGGAACGCCGATTCTGAAGCATCCCAAGCTACTGGAGGCTA
TACTATCAGTTTTCCTTTGACAGTCTTACAGAGTGAATGCCAACAACTGATATGTGAAATTCTAAGAGCAACTCCAGAAG
CTGCGTCAGCAGATGCTGCGGCACAAACTGCTAAACTTGCAAAGAAGGCTCCGAAGAAAGATAAAAGGGATGCATCTGAA
GATGGGGTAACTTTCACCTTTCGGTTCACAGATGCAACTGTATCGATTTCTAATCAGGGAGCGGATCTCATTCGTCAAGG
CTGGGGAAAGAGGGCTCCAAATTCATCACAGGAAGGTTATGGATCTGCAGCAGTTTTGCCTGAACAGGGAATGTATCTAG
CTGCATCTATTTACCGACCTGTCCTTCAGTTTACAGATAAAATTACTTCGATGTTGCCCAAAAAGCATTCTCAGCTTGTG
AATGATGGATTGCTTACATTCACCGAGAACTTTGTGAAGGACCACCTGTTACCGACAATGTTTGTGGACTATAGGAAAGG
CGTACAGCAAGCTATATCAAGTGCTGCCGCATTTAGGCCCCGTGCACATACAACTACTTACACCCCAACCGTAGAAAAGG
GTCGACCTATCTTGCAAGGTCTTTTGGCAATAGATCTCCTTGCAAAAGAGGTTCTTGGTTGGGCTCAAGCCATGCCTAAA
TTTGCTACTGACCTTGTGAAGTATGTTCAGACATTTCTTGAGAGAACATTTGAGAGATGTCGAACAGCATACATGGAGGC
TGTGCTGGAGAAGCTCAGTTACAGGCTCATTGGGAGGCATGATATTGAGAGATTGATGCGACTTGACGCGGCAAGTGCAT
GTTTGCCATCTCAGCTTGGCCATTCTGTTTCTCACTCTGAAGCTGTTGGCTCCGAAGTAGAACTCTGTGAACTATTCTTA
AGTTTGCCGTCAATTAAGCAGGATAATCTAATTCGTGATGACAACAAACTGATTTTGTTAGCGTCGCTTAGTGACTCGCT
TGAATACGTGGCAGACTCTATTGAGAGGCTTGGACAAGCAGTTCCTCGTGCAGCAAGTCAAGCTGAAGGTAATAGCAGGG
ATCAAGCAACTTCTCCAAGGAATCTGGCATCATTTGCTGATGAGTACAGAAAACTTGCGACTGATTGCCTTAAGGTTCTT
CGTGTTGAGATGCAATTGGAAACAGTCTTTCATCTTCAGGAAATGACAAATCGGGAATACCTGGAGGATGAGGATGCTGA
AGAGCCAGACGACTTTGTGATTTCTCTTACTTCACAGATAACACGTAGGGACGAGGGAATGGCGCCTTTCATCTCTGGTG
AGAAGCGCAATTATGTTTTTGGTGGCATTTGTGGAATTGCTGCAAGTGCGTCCATTAAGGCTCTGGCTGACATGAGATCA
ATCAACCTTTTCGGAGTTCAACAAATTTGTAGGAACACTATTGCATTGGAACAGGCCATGGCAGCTATTCCATATGTCGA
TGGTGACAGTGTACAGCAGAACCTAGATCGTGTCCGTACTTATTATGAACTACTGAACATGCCATTCGAGGCGCTACTTG
CATTCATAGCGGAACATGACCAAATGTTTACACCCACAGAGTATTCCAACCTTCTAAAGGTGAATGTTCCTGGAAGAGAT
ACTCCTTCAGATGCTCAAGTCCGCCTTTCCGAAATTCTTTCTCACTAA