Details for Chinese cabbage Locus Brara.E03017

Position : A05 ( 5`- 25222470 .. 25226008 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03017

Protein [Map View]
MRALNSRLVLIDINTSWQASRRLISATATAFSSDSSSSSSFRRTRGARQRIASSKSPASPSPLRKPSDGFTFDVQLPSES
SSSRKTPPSPPTVVELDAFLEILPPATRKELVKHEAIGELIEVVMDLGRKPLARFPSGDWVISEMPVTQQDLKLAVSKVG
DFSDDNRSGINRSLHRISAIRNRKLQIIGLTCRVGRAVSGSAEIIRDLIEGGGSILVIGSPGVGKTTLIREIARMLADEH
RKRVVIVDTSNEIGGDGDVPHSGIGRARRMQVPNVNLQHDVMIEAVENHMPETIIIDEIGTELEALAASTIAQRGVQLVA
TAHGMTIDNIIKNPSLQILIGGIESVTLGDEEARKRKVQKTILERKGPPTFTCAVEMISRTECRVHQRLDVTVDAILAGK
SAPCEIRQIRGEDDVPHKLVTPIPLESLEVEPAPLLNIDFASEVLSDDEDEDFLPSRYKKASRNISVSQRSSPVHVYTYN
VAEADLLRVAEVMGLEDDIEVTDDVGEADVILASSSELKQNPSIRRVAKLHKLPIFVIKSTTMAQMVKAVRMILGRESFG
SAPITIEKKSSVDDIEINDDAPESKPSLEELDALEEVRLAIEYIVIPGGEPVELLPRRSDIIVRQLELVESYQLAVENLG
THLNPRLQILPRRSTKKMPSPKKAGDDSMGNTVTRLPFLKD*

DNA
ATGAGGGCGTTGAATTCACGGCTAGTTCTGATCGACATCAACACCTCATGGCAAGCATCGCGACGGTTGATCTCCGCCAC
CGCAACCGCCTTCTCATCCGACTCCTCCTCCTCCTCCTCATTCCGTCGAACACGTGGCGCGCGTCAGAGGATCGCATCGT
CGAAGTCTCCTGCTTCACCGTCTCCACTACGGAAACCGTCTGATGGATTCACCTTCGACGTTCAGCTACCTTCAGAAAGC
TCCTCATCTCGGAAGACGCCGCCGTCGCCTCCAACGGTGGTGGAGCTCGACGCTTTCCTCGAGATCCTCCCTCCGGCGAC
TCGGAAAGAGCTCGTTAAGCACGAGGCGATCGGGGAATTGATCGAAGTAGTGATGGATTTAGGGAGAAAGCCACTCGCTC
GATTCCCTTCCGGCGATTGGGTGATCTCGGAGATGCCTGTCACACAGCAAGATCTGAAGCTTGCCGTATCAAAGGTTGGT
GATTTTTCGGATGATAACCGGTCGGGGATTAACAGATCGTTGCATCGTATAAGCGCTATACGTAACCGGAAACTGCAAAT
AATTGGTCTAACATGTAGAGTGGGTCGAGCTGTGTCTGGAAGTGCAGAGATTATAAGAGACTTGATAGAGGGAGGAGGAT
CAATCTTGGTCATTGGTTCTCCTGGTGTTGGCAAAACAACTTTAATCAGAGAGATCGCACGGATGTTAGCTGATGAACAC
AGGAAACGTGTGGTGATTGTCGACACGTCAAATGAGATTGGTGGTGATGGTGACGTTCCTCATTCTGGAATCGGCCGTGC
TAGGCGGATGCAAGTTCCAAATGTGAATTTGCAGCACGATGTTATGATTGAGGCGGTTGAGAATCACATGCCTGAGACTA
TAATTATAGATGAGATAGGAACAGAGCTTGAGGCATTAGCTGCTAGCACTATTGCTCAGAGAGGAGTCCAGCTTGTTGCA
ACTGCTCATGGGATGACTATTGACAACATCATCAAGAATCCATCATTGCAGATCCTTATTGGTGGTATTGAGAGTGTGAC
TCTTGGTGATGAAGAAGCAAGGAAACGAAAAGTACAGAAGACAATTCTCGAAAGAAAAGGACCACCAACGTTTACTTGTG
CTGTAGAGATGATTTCGAGAACGGAGTGCCGTGTTCATCAACGGCTAGATGTCACTGTTGATGCTATACTTGCTGGGAAG
TCCGCTCCATGTGAGATCCGTCAGATTCGTGGCGAAGACGATGTTCCTCATAAGCTAGTGACTCCCATTCCTCTGGAGAG
CCTTGAAGTGGAGCCTGCACCACTGCTCAACATAGATTTTGCAAGTGAAGTGCTCTCTGACGACGAAGATGAAGACTTCC
TTCCCTCTCGGTATAAGAAGGCTAGCAGAAACATATCCGTGAGCCAAAGAAGTTCACCTGTTCATGTTTATACTTACAAT
GTCGCCGAAGCTGATCTCCTTCGAGTAGCCGAAGTGATGGGACTGGAAGACGACATAGAAGTGACAGATGACGTTGGAGA
AGCAGATGTCATTCTAGCCTCAAGTTCTGAACTGAAACAGAATCCCTCGATCCGCCGTGTTGCCAAATTACACAAGCTGC
CGATATTTGTCATCAAGTCAACTACAATGGCTCAGATGGTCAAGGCAGTTCGAATGATCCTTGGGAGAGAATCGTTTGGC
TCAGCCCCTATAACCATAGAGAAGAAGTCTTCTGTTGATGATATTGAGATCAACGATGATGCTCCAGAGAGCAAACCCAG
TTTAGAAGAACTTGATGCCCTCGAGGAGGTACGTCTAGCAATCGAATACATAGTCATCCCAGGAGGTGAACCGGTGGAGC
TTCTTCCAAGACGGTCAGACATAATAGTCCGGCAGCTAGAGCTGGTAGAGAGTTATCAACTCGCGGTGGAGAATCTCGGC
ACTCACCTTAACCCTCGTCTTCAGATACTTCCTCGAAGATCCACCAAAAAAATGCCGTCTCCAAAGAAAGCAGGAGATGA
TAGCATGGGAAATACAGTGACTCGTCTTCCTTTCCTCAAGGATTGA