Details for Chinese cabbage Locus Brara.E03015

Position : A05 ( 5`- 25192690 .. 25193844 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03015

Protein [Map View]
METAEEAISAAKEQALILKGKRTKRQRLQSPIPFSIVPPMSSQEPDVEEESTSLVSKEKSLNDDINTNKNDNNVLINGVT
SPASSSSNNNATLKTAADEEDQDMANCLILLAQGHYTPQQQPQQTRQFMMSYQESGNNNNNAYRSSSRRFLETSSPNGTT
SGGRAGYYVYQCKTCDRTFPSFQALGGHRASHKKPKAAAGLHSDHDLKKSIYNDAVSLHLNNVPTATPNNNSSHRSLVVY
GKAGNNKVHECGICGAEFTSGQALGGHMRRHRGAVVASAASASTATVRVAATAGTANTALSLSPMSFDHMSVHPVQGPVK
RARSAVVSLDLDLNLPAPEDVNRVNGLSFASKQEQEHEHEQTQQREEQKSIVLSSAPTLVDCHY*

DNA
ATGGAAACAGCAGAGGAGGCGATATCGGCAGCTAAGGAGCAAGCCTTGATCCTTAAAGGGAAGAGGACTAAGAGGCAGCG
TCTGCAGTCCCCAATCCCTTTCTCTATCGTCCCTCCTATGTCTTCTCAAGAACCTGATGTGGAAGAAGAGTCCACCAGTC
TTGTTTCCAAGGAGAAGAGTCTCAATGATGATATTAACACCAACAAGAATGATAACAACGTTTTGATCAATGGTGTGACA
TCTCCTGCCTCTTCATCTTCTAACAACAATGCAACATTAAAGACCGCCGCTGACGAGGAAGACCAAGACATGGCTAATTG
TTTGATCCTCCTCGCCCAAGGTCACTATACCCCTCAACAACAACCACAACAAACAAGACAGTTTATGATGAGTTACCAAG
AATCTGGTAATAACAACAACAATGCGTATAGATCTAGCAGCAGAAGGTTCCTCGAGACGTCTTCACCTAATGGAACCACG
AGTGGAGGCAGAGCCGGTTACTATGTTTACCAATGCAAAACGTGTGACCGGACTTTCCCTTCTTTCCAAGCTCTTGGTGG
CCATAGAGCCAGCCACAAGAAGCCTAAAGCCGCAGCGGGTCTTCACTCCGACCATGACCTCAAGAAGTCTATATACAACG
ACGCCGTTTCTCTTCATCTCAACAACGTCCCCACCGCAACTCCTAACAACAATAGTAGCCACAGGTCGCTTGTGGTATAC
GGCAAAGCGGGTAACAATAAAGTCCATGAATGTGGGATATGTGGAGCTGAGTTCACGTCCGGACAAGCCTTAGGTGGTCA
CATGAGACGTCATAGAGGCGCAGTGGTGGCCTCAGCAGCATCCGCTTCCACCGCAACGGTTAGGGTTGCGGCCACTGCGG
GTACAGCAAACACGGCCTTGTCATTGTCACCTATGTCGTTTGACCACATGTCGGTTCATCCGGTTCAGGGTCCGGTTAAG
AGAGCGAGGAGTGCGGTTGTGTCGTTAGATTTGGATCTGAATCTACCTGCCCCGGAAGATGTGAATCGGGTCAACGGGTT
AAGCTTTGCTTCAAAGCAAGAACAGGAACATGAACATGAACAAACGCAACAGAGAGAAGAACAAAAGTCTATTGTTTTGT
CTTCGGCTCCTACATTGGTGGATTGCCATTACTAA