Details for Chinese cabbage Locus Brara.E03014

Position : A05 ( 5`- 25187879 .. 25190724 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03014

Protein [Map View]
MGRESVAVVSSPPTATATATARGTATVAATSLAPGFRFHPTDEELVSYYLKRKVMGKPVRFDAIGDVDIYKHEPWDLAVF
SRLKTRDQEWYFYSALDKKYGNGARMNRATNKGYWKATGKDREIRRDIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRLV
DYETESNGNLVQDAYVLCRVFHKNNIGPPSGNRYAPFLEEEWADEGVALIPGVDVRVRAEPLPVANGNNQMDQEIQSASK
DLININEPPRETTPMDIEVNHQNHHENAPKPQENNNNNHYDEAEEALKLEQAEEDERPPPACVLNKEAPLPLLQYKRRRQ
NEPNNNSSRTTQDHCSSTITTVDNTPITLISSSTAAATNTAISALLEFSLMGISAKKENTPQPPNKEAYPPAPLPSTEEK
LNDLQKEVHQMSVERETFKLEMMSAEAMISILQSRIDALRQENDELRKNNATKGQAVL*

DNA
ATGGGTCGCGAATCTGTGGCTGTGGTGTCTTCTCCGCCGACGGCGACTGCGACTGCGACTGCGAGGGGTACTGCTACTGT
TGCGGCGACATCGCTTGCTCCTGGGTTTCGATTTCATCCGACTGATGAAGAACTCGTGAGCTATTACTTGAAGAGAAAGG
TTATGGGTAAGCCCGTACGTTTCGATGCGATTGGGGATGTTGATATCTACAAGCATGAGCCTTGGGACTTAGCAGTGTTT
TCGAGGTTGAAGACAAGAGACCAAGAATGGTACTTCTACAGCGCGTTAGATAAGAAGTACGGGAACGGCGCTAGAATGAA
CCGAGCCACTAACAAAGGCTACTGGAAAGCCACCGGAAAAGACAGAGAAATCCGCCGTGACATTCAGCTGCTCGGTATGA
AAAAGACACTCGTTTTCCACAGCGGGCGTGCCCCGGATGGGCTCCGCACCAACTGGGTCATGCACGAGTATCGCCTTGTG
GACTATGAAACTGAATCCAATGGAAACCTCGTGCAAGATGCATATGTGTTGTGCAGAGTGTTCCACAAGAATAACATTGG
GCCACCAAGTGGGAACAGATACGCGCCATTCTTGGAAGAGGAATGGGCTGATGAGGGAGTCGCTCTGATTCCAGGAGTAG
ACGTTAGGGTCAGGGCAGAGCCGCTACCAGTAGCTAATGGAAACAACCAGATGGACCAGGAAATTCAGTCAGCAAGCAAG
GACCTCATTAACATCAACGAGCCACCAAGAGAGACTACCCCAATGGATATCGAAGTTAATCATCAGAATCATCATGAGAA
TGCCCCTAAGCCGCAGGAGAATAACAACAATAACCATTATGATGAAGCTGAGGAAGCACTCAAACTTGAGCAAGCGGAAG
AAGATGAGCGTCCTCCTCCTGCATGTGTTCTCAACAAAGAAGCTCCATTGCCTCTCCTTCAATACAAACGAAGACGCCAA
AACGAACCAAACAACAACTCAAGCAGGACCACACAGGATCACTGTTCGTCCACAATAACAACCGTCGACAATACACCAAT
AACTTTAATCTCATCATCTACTGCTGCTGCCACCAACACCGCCATCTCTGCATTGCTTGAATTCTCTCTCATGGGTATAT
CCGCAAAGAAAGAAAACACACCGCAACCTCCTAACAAGGAAGCTTATCCTCCTGCTCCGCTTCCATCTACTGAAGAGAAG
CTTAATGATCTCCAGAAGGAGGTTCACCAGATGTCTGTTGAGAGAGAGACGTTCAAGCTTGAGATGATGAGTGCAGAGGC
TATGATCAGTATTCTCCAGTCGAGGATCGATGCACTGCGCCAGGAGAACGATGAGCTGAGGAAGAACAACGCCACCAAGG
GACAAGCGGTGCTCTAA