Details for Chinese cabbage Locus Brara.E03011

Position : A05 ( 5`- 25175969 .. 25180015 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03011

Protein [Map View]
MGEIVFTEKQEALVKESWEILKQDIPRYSLHFFSQILEIAPAAKDMFSFLRDTDEVPHNNPKLKAHAVKVFKMTCETAIQ
LREKGKVAVPDTTLQYLGSVHLKSGVLDPHFEVVKEALVRTLKEGLGEKYNEEVEGAWSQAYDHLALAIKAEMKQENSQK
P*

DNA
ATGGGAGAGATTGTGTTTACAGAGAAGCAAGAAGCTTTGGTGAAGGAGTCTTGGGAGATACTGAAGCAAGACATCCCCAG
ATACAGCCTTCACTTCTTTTCACAGATACTGGAGATAGCACCAGCAGCAAAAGACATGTTCTCTTTCTTAAGAGACACAG
ATGAAGTGCCTCACAACAATCCTAAACTCAAAGCTCATGCTGTCAAAGTTTTTAAGATGACATGTGAAACAGCAATACAG
CTGAGGGAGAAAGGCAAAGTGGCTGTGCCTGACACAACCCTCCAATACCTGGGCTCTGTCCATCTCAAAAGTGGAGTTCT
TGATCCTCACTTTGAGGTGGTGAAAGAGGCTTTGGTGAGGACACTGAAAGAAGGGTTGGGGGAGAAGTACAATGAAGAAG
TGGAAGGAGCTTGGTCTCAAGCTTATGATCACTTGGCTTTAGCCATTAAGGCCGAGATGAAACAAGAAAACTCACAGAAA
CCCTGA