Details for Chinese cabbage Locus Brara.E03008

Position : A05 ( 5`- 25163030 .. 25165865 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03008

Protein [Map View]
MTMENEFDSKLSLQGNGEGSSISRSKSFAFKAPQENFTIQDFELDKIYGVGSYSKVVRATKKKDGGVYALKIMDKKFITK
ENKTAYVKLERIVLDQLDHPGIVKLFFTFQDNFSLYMALESCEGGELFDQITRKGRLSEDEARFYGAEVVDALEYIHTMG
LIHRDIKPENLLLTSDGHIKIADFGSVKPMQDSQITLLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTL
YQMLSGTSPFKDASEWLIFQRIIARDLKFPNHFSEAARDLIDRLLDTDPSRRPGAGPEGYASLKRHPFFKGVDWKKPRSQ
TPPKLAPDPSSQSASPERDGSPWNPTHVGDASAMQNNGPSSTSESSGSITRLASIDSFDSRWQQFLEPGESVIMLSAVKK
LRKITSKKVQLILTNKPRLIYVDPSKLVAKGNIIWSDNSSDLNVQISSPSHFKICTPKKVLSIEDSKQRALQWRKAIETL
QNR*

DNA
ATGACAATGGAGAATGAATTTGATTCAAAGCTTTCTCTTCAAGGGAATGGTGAAGGCAGCAGCATATCAAGAAGCAAGAG
CTTCGCATTCAAGGCTCCTCAGGAGAATTTCACCATCCAGGATTTCGAGCTCGACAAGATCTATGGCGTTGGCTCTTATT
CAAAGGTTGTTAGGGCGACGAAGAAGAAGGATGGAGGCGTGTACGCGTTGAAGATCATGGACAAAAAGTTTATCACCAAG
GAGAATAAAACAGCTTATGTCAAACTCGAGAGGATTGTTCTTGATCAGCTTGACCATCCTGGGATTGTCAAACTCTTCTT
CACATTTCAAGATAACTTCTCTCTATACATGGCGCTTGAATCTTGTGAAGGTGGGGAGCTTTTTGACCAAATCACCAGAA
AAGGTCGTCTATCAGAGGATGAAGCTCGGTTCTACGGTGCAGAAGTTGTGGATGCTCTTGAGTATATACATACTATGGGA
CTGATACATAGAGATATTAAGCCGGAGAATCTGTTGCTGACTTCAGATGGACACATTAAGATTGCTGATTTTGGTAGTGT
AAAGCCAATGCAAGACAGCCAGATCACTCTACTTCCCAATGCAGCTTCCGATGATAAGGCCTGCACTTTTGTCGGTACGG
CTGCATATGTTCCTCCTGAAGTTCTCAACTCCTCTCCAGCAACTTTCGGAAACGATCTTTGGGCACTGGGCTGCACTCTG
TACCAAATGCTATCAGGAACATCTCCATTCAAAGACGCAAGTGAATGGCTGATTTTCCAAAGAATCATTGCTAGAGACTT
AAAGTTCCCAAATCATTTCTCAGAAGCAGCAAGAGACCTCATCGACCGGTTGCTGGATACAGATCCTAGTAGAAGACCAG
GAGCTGGACCAGAAGGTTACGCTTCTCTCAAGAGACATCCTTTCTTCAAAGGAGTTGACTGGAAAAAACCAAGATCACAA
ACTCCTCCTAAACTAGCTCCAGATCCTTCGTCTCAGTCAGCATCTCCTGAGAGAGACGGTTCTCCATGGAACCCAACACA
TGTTGGAGATGCCTCAGCCATGCAGAACAATGGTCCCTCTTCAACTTCTGAATCCTCTGGTTCCATAACCAGGCTTGCCT
CCATAGACTCTTTTGATTCGAGATGGCAACAGTTTCTTGAACCGGGAGAATCGGTTATAATGCTATCAGCAGTGAAGAAG
CTACGGAAAATCACGAGTAAGAAGGTGCAGCTGATACTCACCAACAAACCGAGACTGATCTACGTCGATCCATCAAAGCT
TGTTGCCAAAGGGAACATCATCTGGTCTGATAACTCCAGTGACCTCAACGTTCAAATCTCAAGTCCTTCCCATTTCAAGA
TTTGCACACCGAAGAAGGTTCTATCGATTGAAGACTCGAAACAACGAGCTTTGCAGTGGAGAAAGGCAATTGAAACTCTT
CAAAACCGTTGA