Details for Chinese cabbage Locus Brara.E03004

Position : A05 ( 5`- 25153600 .. 25155440 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03004

Protein [Map View]
MEATDGVWGEIERSESYLVCSMYEEAESLSSSILKGIFGNVETLGDHQLLDMLESAGMVLVQSLNGLGRAGEIVNELRQV
FGETAAVPVQVLLTGICLQISNGSYSGVREILEEFFSVWVYKDNRYILNDAGLIKKVFHGKTSLDVDEYMEVVELYTFGV
LGKDTNDVCLAVSWVEQAALSEERRQGLLRRLDSLLSLKSPNVQEATSLEETPSYDVVNINKSLANEKNDYILKLSKQHE
PWSSRPLSLSLGNTRFSMSRGKVAISLVGLIICYALQRKRAALIRIIRRQMESTKKAIVDFWKLAFSYQVNPLAAIQPIP
STTT*

DNA
ATGGAGGCCACTGATGGTGTTTGGGGAGAAATCGAACGTTCTGAGAGCTACCTAGTTTGCTCTATGTATGAAGAGGCAGA
GTCATTATCTTCCTCCATACTAAAAGGAATCTTTGGCAACGTTGAAACTCTTGGTGATCATCAATTGCTTGACATGCTTG
AATCTGCTGGCATGGTTCTAGTCCAGTCCTTGAATGGACTCGGCAGGGCAGGTGAGATTGTAAATGAGCTAAGACAAGTG
TTTGGCGAAACTGCAGCTGTTCCTGTTCAAGTTCTTCTCACTGGAATATGTCTTCAAATATCAAACGGTTCCTACTCGGG
TGTACGTGAGATTCTGGAAGAGTTCTTTAGCGTATGGGTTTACAAGGACAACCGCTATATCCTAAATGATGCTGGATTAA
TTAAAAAAGTGTTCCACGGGAAAACATCGTTGGATGTTGATGAGTACATGGAAGTTGTAGAGCTGTATACCTTTGGAGTT
CTTGGGAAAGACACAAACGACGTGTGTCTAGCCGTTTCATGGGTTGAGCAAGCTGCGTTGTCTGAGGAAAGACGACAGGG
ACTTTTGAGAAGATTGGATTCTTTACTTTCTCTCAAATCACCAAACGTTCAAGAAGCTACTTCTTTAGAGGAAACTCCTT
CTTACGATGTGGTGAATATCAACAAATCTTTGGCTAATGAAAAGAATGATTATATCCTGAAACTCTCTAAACAACATGAA
CCTTGGTCGTCTCGTCCTCTTAGCCTAAGTCTTGGTAATACCCGATTCAGCATGTCCAGGGGAAAAGTTGCCATAAGCCT
CGTTGGATTAATCATATGCTACGCTTTACAAAGAAAACGAGCTGCTTTAATACGGATCATTCGCAGACAAATGGAGTCCA
CGAAGAAAGCAATTGTAGATTTCTGGAAGCTTGCGTTTTCATACCAAGTGAATCCTCTTGCAGCTATTCAACCAATACCA
AGCACCACCACTTGA