Details for Chinese cabbage Locus Brara.E03001

Position : A05 ( 5`- 25146857 .. 25147845 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03001

Protein [Map View]
MAWWEQWGRDEEKMFEDALVLTEIDPNRFETIASYLEMPLEVVKHHYDALVHDVELIESGRYGTTDYQDHADGILSPETK
HMEKDKKRGRPWTAKEHGEFLKGLDEFGRGDWKSVSRKYVKTRSARQVASHAQKYFQRQDMENHAKKRSSIHDMTLVDDN
DVDVNE*

DNA
ATGGCTTGGTGGGAGCAGTGGGGAAGGGACGAAGAGAAAATGTTCGAGGACGCGCTGGTGCTCACGGAGATCGATCCTAA
CAGGTTCGAGACTATCGCCAGCTATCTTGAGATGCCGCTCGAGGTTGTGAAGCACCACTACGACGCTTTGGTTCACGATG
TTGAACTTATCGAATCGGGTCGCTATGGTACTACCGATTATCAAGATCACGCAGATGGAATCCTCTCACCCGAGACTAAA
CACATGGAGAAAGATAAAAAGAGAGGAAGACCGTGGACAGCAAAGGAGCACGGAGAATTTCTGAAGGGATTAGACGAGTT
TGGGAGAGGAGATTGGAAGAGTGTCTCGAGAAAGTATGTGAAGACAAGGTCTGCAAGGCAAGTCGCAAGCCATGCACAAA
AGTATTTCCAGAGGCAAGACATGGAGAATCATGCAAAGAAGCGCTCCAGTATCCATGATATGACTTTGGTTGATGATAAT
GATGTTGATGTTAATGAATAA