Details for Chinese cabbage Locus Brara.E02996

Position : A05 ( 5`- 25135359 .. 25137383 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02996

Protein [Map View]
MAGVNLQLRHSVTQLFPSISSSPPRPPQRFQLGTSPSRVLFCNLRANSAAAPPLRTTRRSDIIAASSVGSPTSSDSVVGD
RDELGKIPLLEVKDLRAVIVESRQEILKGVNLVVYEGEIHAVMGKNGSGKSTFSKVLVGHPDYEVTGGSIVFKGQNLLDM
EPEERSLAGLFMSFQSPVEIPGVSNMDFLNMAFNARKRKLGQPELDPIQFYSHLVSKLEVVNMKTDFLNRNVNEGFSGGE
RKRNEILQLAVLGAELAILDEIDSGLDVDALQDVAKAVNGLLTPKNSVLMITHYQRLLDYIKPTLIHIMENGRIIKTGDK
SLAKLLEKEGYKAISG*

DNA
ATGGCCGGCGTTAATCTACAGCTCCGTCACTCCGTTACTCAATTGTTTCCATCAATTTCTTCTTCTCCTCCTCGTCCTCC
TCAACGATTCCAGCTCGGAACGTCACCTTCTCGTGTTCTCTTCTGTAACCTCCGAGCTAACTCCGCCGCCGCACCACCCC
TGCGAACCACTCGCCGCTCAGATATTATAGCCGCGTCTTCCGTCGGTTCTCCCACCTCGTCAGATTCGGTGGTGGGAGAC
CGAGATGAATTGGGAAAGATCCCTTTGCTTGAGGTCAAGGATCTGAGAGCTGTGATTGTTGAATCGAGGCAGGAGATACT
AAAAGGCGTCAACTTGGTTGTATACGAAGGAGAGATACACGCAGTGATGGGGAAGAATGGTTCAGGGAAGAGCACATTCT
CTAAGGTTCTTGTTGGTCATCCTGATTATGAAGTGACGGGAGGGAGTATTGTGTTTAAAGGGCAGAATCTGCTTGATATG
GAGCCTGAGGAGAGATCTCTTGCCGGTCTATTCATGAGTTTTCAGTCCCCGGTTGAGATCCCTGGTGTTAGCAATATGGA
TTTTTTGAATATGGCATTTAATGCTCGCAAAAGAAAGCTCGGTCAGCCAGAGCTTGATCCAATCCAGTTCTACAGCCACT
TGGTATCAAAACTTGAAGTTGTGAATATGAAGACCGATTTTCTCAACCGAAATGTCAATGAAGGGTTTAGCGGTGGTGAA
AGGAAACGTAACGAGATTCTACAGTTAGCGGTCCTCGGAGCCGAGCTGGCTATACTGGACGAGATAGATTCAGGGTTGGA
TGTTGATGCTCTTCAAGATGTGGCAAAGGCGGTGAATGGGCTTTTGACACCAAAAAACTCTGTTCTGATGATAACTCACT
ATCAACGCCTACTTGACTACATCAAACCAACTCTCATACACATCATGGAGAATGGACGAATCATAAAAACAGGAGACAAG
TCCTTGGCAAAATTACTGGAAAAAGAAGGCTACAAAGCCATATCCGGTTAG