Details for Chinese cabbage Locus Brara.E02994

Position : A05 ( 5`- 25129339 .. 25133011 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02994

Protein [Map View]
MSWPTESELTAIKEAVSKMTGRDTEEVRVVVAPYRICPLGAHIDHQGGAVSAMTINKGILLGFVPSGDTQVQLRSAQFEG
EVCFRVDEIQHPVDLANKNGAPKDQSIWGTYARGALYALQTSNKNVKQGIVGCISGSDGLDSSGLSSSAAVGVAYLLALE
NANELTVSATENIEYDRLIENGYLGLRNGILDQSAILLSSYGCLTYMDCKTMDHKLIQGPELEKPFRILLAFSGLRQALT
TNPGYNLRVAECQEAAKVLLTASGNSELEPTLCNVEHAVYEAHKHELKPVLARRAEHYFSENMRVTKGLEAWATGNLEEF
GKLISASGLSSIENYECGAEPLIQLYKILLKAPGVYGARFSGAGFRGCCLAFVDAETAEEAASYVKDEYEKAQPEFAKKL
NGGKPVLICEAGDSARVL*

DNA
ATGTCTTGGCCTACAGAATCCGAGCTAACTGCCATTAAGGAGGCAGTGTCCAAGATGACCGGGAGAGACACAGAGGAAGT
TCGCGTGGTGGTAGCGCCTTATCGTATATGTCCTCTGGGAGCTCACATTGATCACCAGGGTGGGGCTGTATCGGCTATGA
CGATTAATAAAGGGATCCTTCTTGGTTTTGTTCCATCGGGCGATACTCAGGTCCAGTTGCGTTCTGCACAGTTTGAAGGA
GAAGTATGTTTCAGAGTAGATGAAATCCAGCACCCAGTAGACTTAGCAAATAAAAATGGTGCACCAAAGGATCAAAGCAT
CTGGGGCACTTATGCCAGAGGAGCGCTTTATGCGTTACAGACGAGCAATAAGAATGTCAAACAGGGCATTGTTGGCTGCA
TCAGTGGCTCGGATGGGCTAGATAGTTCTGGGCTTAGTTCATCAGCTGCTGTTGGTGTGGCATACCTGCTAGCTTTAGAG
AATGCCAACGAATTGACCGTATCCGCAACAGAAAATATCGAATATGACAGGCTTATTGAGAATGGGTATCTGGGTCTGCG
GAATGGAATTTTGGATCAATCAGCTATTTTGCTATCGAGTTATGGGTGTCTAACATACATGGACTGCAAGACTATGGACC
ACAAGCTCATACAGGGTCCTGAACTGGAGAAACCATTCAGGATATTGTTAGCATTCTCAGGCCTGAGGCAGGCATTGACC
ACCAACCCAGGATATAACCTGCGAGTTGCTGAATGCCAAGAAGCTGCGAAAGTTCTCTTGACTGCATCTGGGAACAGCGA
GCTGGAACCTACCTTGTGCAACGTTGAGCATGCGGTCTATGAAGCTCACAAGCATGAGCTGAAACCGGTTTTAGCTAGAA
GAGCGGAGCATTACTTCTCGGAAAACATGCGGGTTACTAAAGGATTGGAAGCGTGGGCTACAGGCAATCTTGAAGAATTT
GGAAAGCTTATTTCAGCGTCTGGCTTGAGCTCTATTGAGAATTACGAATGCGGTGCGGAGCCACTGATTCAGCTATACAA
GATTCTACTGAAGGCACCTGGTGTATATGGAGCACGGTTCAGTGGTGCAGGCTTCAGGGGATGTTGTCTAGCCTTTGTGG
ATGCAGAAACAGCTGAGGAAGCTGCTTCATATGTGAAGGATGAATATGAAAAGGCCCAACCAGAGTTTGCCAAGAAACTG
AATGGAGGTAAACCTGTTCTCATCTGTGAAGCAGGTGACTCTGCTCGTGTTCTCTGA