Details for Chinese cabbage Locus Brara.E02990

Position : A05 ( 5`- 25100569 .. 25102077 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02990

Protein [Map View]
MILSKRWGLVWTMVTKLEYKDTWKEGDKSIWRLLEKSLQLHKAPVLESLNIQVECQFCDDADVGKCVSYAVDHKLPSNVY
TSKTLVKLTLSCRTLVVDVPSLPCLPSLQRLALLSVVYKDEKSHVRLLSNCPALTHLEVFRNLSDNVTRFIVKVSSLKSF
RYTQHKRAPSRSLVLDSPGLRRLTLSDPHGDLDSIQNIPHLDWAYVCHFVPNPKDKKFLTSFSSVKVLRLSLRNDVSLCS
NGVPLSWNRPSSVPVCLLSHLEIFVWKEFAGRRQERAFVAYILANSKRLKTAEFSPRYNLYEKEKEKMMELLKSMYRASA
SSQLDFLI*

DNA
ATGATTTTGTCCAAACGATGGGGTTTGGTCTGGACGATGGTGACTAAACTCGAGTATAAGGATACATGGAAAGAAGGGGA
TAAGAGCATTTGGCGCTTACTCGAAAAGTCTTTGCAACTCCACAAAGCACCTGTACTAGAAAGCTTGAATATCCAAGTTG
AATGTCAGTTTTGCGATGATGCAGATGTAGGAAAGTGCGTCTCATACGCTGTTGACCACAAACTACCATCGAACGTTTAC
ACCTCAAAAACGCTAGTGAAACTGACTCTATCATGTAGGACTCTCGTAGTGGATGTTCCTTCCCTACCTTGCCTTCCTTC
GCTTCAGAGGCTGGCCCTTCTCAGTGTGGTGTATAAAGATGAAAAGTCTCATGTCAGACTTCTATCGAATTGCCCTGCCC
TCACACATTTGGAAGTGTTCCGAAACTTGAGTGACAATGTGACAAGGTTCATTGTGAAAGTTTCTTCTCTAAAAAGTTTT
AGATACACGCAACACAAAAGAGCTCCTTCTAGGTCCTTGGTTTTAGACTCCCCTGGATTACGACGCCTTACTTTAAGTGA
TCCGCATGGAGACTTAGACTCGATCCAGAATATACCTCACCTTGACTGGGCTTATGTTTGTCACTTTGTTCCAAACCCGA
AAGACAAGAAGTTTCTGACATCTTTTTCCTCTGTCAAGGTTCTCCGTTTGAGTCTAAGAAACGATGTGTCTCTTTGCTCT
AATGGTGTCCCACTTTCGTGGAACAGACCAAGTTCTGTACCGGTATGCTTGTTGTCCCATCTCGAGATCTTTGTATGGAA
AGAGTTTGCAGGAAGAAGGCAAGAGAGAGCGTTCGTGGCGTACATCCTTGCAAACTCAAAGCGTTTAAAGACGGCTGAAT
TTTCTCCCAGATACAATCTCTACGAAAAAGAGAAAGAGAAGATGATGGAGCTGTTAAAATCTATGTATAGGGCTTCGGCA
TCATCTCAACTAGATTTCTTGATATGA