Details for Chinese cabbage Locus Brara.E02988

Position : A05 ( 5`- 25093620 .. 25095663 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02988

Protein [Map View]
MAAAAAAAAMTEKEAMVDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFSPFPTSYLRLAAHRVAQHYGLVTMA
LDNGNGAVDGSDNRILVTKTAESRFPHVCLSEIPVKQPENGRPEGGFKIAIKARPKRGSGSGGSGSGVQQNLQRSVEERK
EEYDKARARIFNSPGSSDSEDSSSLRAPPPEVKNTSVNRNEAEVAVSNNSLDAGGSRESGRTSVAIIRDREKDRYDPDYD
RSYDRYVVDPAYRYVRVMPSGQSFNPMPMHIPFHDGGFPQMPRGHQANLNYGHPFNPAMSPFISNPAAYTPWPNSPAMNY
AHSLNGPDTNLFRHPSASNP*

DNA
ATGGCCGCCGCCGCCGCCGCCGCCGCTATGACAGAGAAGGAAGCTATGGTGGATCCTTTTCTGGTCGAAGCTCTCCAGAA
TCCTCGTCATCGTCTCACCATTTTGCGGATGGAGCTTGATATACAAAAGTTCTTTCAAAACCCTGAGCAGCTTCAGTTCG
AGTTCTCTCCTTTCCCAACCTCTTACCTTCGTCTCGCTGCACATCGAGTTGCTCAGCACTATGGTTTGGTGACCATGGCT
TTGGACAATGGTAACGGTGCAGTAGATGGATCAGACAACAGGATCCTTGTGACGAAAACCGCGGAGAGCAGGTTTCCTCA
CGTCTGCTTATCCGAAATCCCGGTTAAGCAACCCGAGAACGGTAGACCTGAGGGTGGTTTCAAGATTGCGATCAAGGCGA
GACCCAAGAGAGGATCTGGATCCGGAGGTAGCGGATCAGGAGTGCAGCAGAATCTTCAGAGAAGCGTTGAGGAGAGGAAA
GAAGAGTATGATAAGGCCAGGGCTCGGATCTTTAACAGCCCTGGTAGTTCTGACTCTGAAGATTCTTCGTCGCTCCGAGC
TCCTCCTCCTGAAGTGAAAAACACAAGTGTTAACCGTAATGAGGCTGAGGTGGCGGTCAGTAATAATTCTCTTGATGCTG
GTGGTTCTCGAGAATCTGGAAGGACTTCTGTAGCCATTATCAGAGATAGAGAGAAAGATCGATATGATCCGGATTATGAC
AGGAGCTATGACAGGTATGTCGTGGATCCCGCCTACAGGTACGTTAGGGTTATGCCGTCTGGTCAAAGCTTTAATCCGAT
GCCAATGCACATTCCTTTTCACGATGGAGGTTTCCCGCAGATGCCAAGAGGTCATCAAGCTAATCTAAACTACGGTCATC
CGTTTAATCCTGCCATGAGTCCCTTTATTAGTAACCCTGCTGCTTATACACCGTGGCCAAACTCACCAGCTATGAACTAT
GCGCATTCGTTGAACGGCCCAGACACGAATCTTTTCAGGCATCCATCTGCGAGCAATCCCTGA