Details for Chinese cabbage Locus Brara.E02985

Position : A05 ( 5`- 25084635 .. 25087363 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02985

Protein [Map View]
MKPSEHSLDNWRDYFRRGDSDIFGIINHAIILAAADFPKELKSRRDGIAQLLFSCNASRSCIGCGHEDNHETVGVSDDSG
GGGDDGEDEKKLNDGEIVGDEVVRIRDILLNNDDESNSVLLRSLRKLESMSLSVDLLKDTEIGKAVNGLRRHGSDEIREL
AKALFAEWKEMVDQWMNSVNEVAGDEGTPESANYSVVDEAEDFPSPPHDLDFLAPESTGFELSQILDALDCDGNPRHSVE
PKRKSMRRPEGTHEANLVGRYNKNQQTRREEIDSRPMKHSATVFDEPRRQPKQTREQMVQPIQRKPIVIPEQKRNSQQDK
LKALDLDARFEFAKRKLQESYQQHDKAKRQRTIQVLETIPKQGKAHKPQLKRPVRR*

DNA
ATGAAACCATCGGAGCACTCGTTGGATAACTGGAGGGACTATTTCCGGCGAGGAGACTCTGATATTTTCGGGATCATCAA
TCACGCCATCATCCTCGCCGCCGCTGATTTCCCGAAGGAGCTCAAATCCAGAAGAGACGGAATCGCCCAGCTTCTATTCT
CTTGTAATGCGAGCCGCAGCTGCATCGGATGTGGCCACGAGGATAACCACGAGACGGTTGGAGTCTCCGATGATTCTGGT
GGAGGTGGCGATGATGGAGAAGATGAGAAGAAACTGAACGATGGTGAGATTGTTGGTGATGAGGTCGTGAGGATCAGAGA
TATTTTGTTGAATAATGATGATGAGTCGAACTCTGTGTTACTACGTTCCCTGAGGAAGCTTGAGTCCATGTCTCTGAGTG
TGGACCTTCTCAAGGATACTGAAATTGGAAAGGCTGTTAATGGCTTGAGGAGACATGGTTCTGATGAGATTAGGGAACTT
GCAAAGGCTCTCTTCGCAGAGTGGAAGGAGATGGTGGACCAATGGATGAACAGCGTTAATGAAGTTGCTGGTGATGAAGG
GACGCCAGAGTCTGCAAATTATTCGGTAGTTGATGAAGCAGAAGACTTTCCTTCTCCTCCGCATGATTTAGATTTTTTGG
CTCCTGAGTCTACTGGTTTTGAACTCTCTCAGATCTTAGATGCCTTGGACTGCGATGGAAATCCTCGTCACAGTGTGGAG
CCTAAAAGAAAATCGATGAGGAGACCCGAGGGTACCCATGAAGCTAATTTGGTTGGGAGGTACAATAAGAATCAACAGAC
AAGGAGAGAAGAAATTGATTCTAGACCTATGAAGCATTCAGCCACCGTCTTCGACGAGCCTAGAAGACAACCAAAGCAAA
CTAGAGAACAAATGGTACAACCAATCCAAAGAAAACCGATTGTTATTCCTGAGCAGAAGCGGAACTCTCAACAAGATAAA
CTCAAAGCTCTGGATCTAGACGCAAGGTTTGAGTTCGCAAAGAGGAAACTCCAAGAGAGCTACCAACAACATGATAAGGC
CAAGAGACAGAGGACAATACAAGTACTTGAAACGATTCCAAAGCAGGGTAAAGCCCATAAACCACAACTTAAGAGACCCG
TGCGAAGGTAG