Details for Chinese cabbage Locus Brara.E02984

Position : A05 ( 5`- 25082886 .. 25085234 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02984

Protein [Map View]
MNLLNTTTRIFFLHQPKQSIITPSSLSFNAKLSLDSSKTNFQMSCLISGQSFRRPAKRFIVSNAASPSLSGSPDQFLDGG
AQTKEETITETEQDPINLADPDSCFCEFQGVNIHHKVFDPRTISDDAPITSVDAQGTTPKVEFPMILLHGFGASVFSWNR
VMKPLARLVRSKVLAFDRPAFGLTSRILHPFSGVTNDAKPLNPYSMVYSVLTTLYFIDFLASEKAILVGHSAGCLVAVDS
YFEAPERVAALILVAPAIFAPRPVNTAAGAGDNRGENGPRSKFLGTLVELSKVIIGAISTVLTGMASMLSSLYKKALAAF
LRSYLGVMLVRMAINKFGVTAVRNAWYDSKQVTDHVVQGYTKPLKAKGWDKALVEFTVATLTDNNGSEKKPPLSKRLQEI
KCPVLIVTGDTDRIVPAWNAERLSRAIPGSVFEVIKKCGHLPQEEKPDEFISVVAKFLGDVFGGSQREQQVDLKFQGSVS
*

DNA
ATGAATTTATTAAACACCACCACACGCATCTTCTTCTTACACCAACCAAAGCAGAGTATCATAACTCCCTCTTCCTTATC
TTTCAATGCAAAGCTTAGTTTAGATTCTTCTAAAACCAACTTTCAGATGTCTTGCTTAATCTCCGGCCAATCATTTCGCC
GTCCGGCTAAACGTTTCATCGTCTCCAATGCTGCTTCTCCTTCTCTCTCTGGCTCCCCAGATCAATTTCTTGATGGTGGA
GCCCAGACCAAAGAGGAGACCATAACTGAAACAGAGCAGGATCCAATAAACTTAGCTGATCCAGACAGCTGTTTCTGTGA
GTTTCAAGGTGTTAACATACACCACAAAGTGTTTGATCCACGGACAATCTCTGATGATGCTCCCATCACAAGCGTCGATG
CTCAAGGAACAACCCCAAAAGTCGAGTTTCCAATGATTCTTTTACACGGCTTTGGCGCTTCTGTGTTCTCCTGGAACAGA
GTTATGAAGCCTTTAGCTCGCCTTGTCCGTTCGAAAGTCCTCGCCTTTGATAGACCCGCGTTTGGATTGACTTCTCGGAT
CCTTCACCCGTTTAGTGGTGTTACCAATGATGCAAAGCCGTTGAATCCGTACTCCATGGTGTATTCAGTGCTAACCACGT
TGTACTTCATCGATTTTCTTGCTTCCGAGAAGGCCATTCTTGTAGGGCATTCTGCAGGTTGTCTTGTAGCTGTGGATTCT
TATTTTGAAGCTCCTGAGCGTGTTGCTGCACTCATTCTCGTTGCTCCAGCTATATTCGCTCCTCGTCCAGTCAACACAGC
TGCTGGTGCTGGAGATAACCGTGGCGAAAATGGTCCCAGGAGCAAGTTTCTAGGGACTTTAGTTGAGTTAAGCAAAGTCA
TTATAGGAGCAATTTCGACAGTTCTAACAGGAATGGCGAGTATGCTGAGTTCTCTCTACAAGAAAGCTTTGGCAGCTTTC
CTCAGATCATATCTTGGAGTCATGCTGGTGAGAATGGCAATCAATAAGTTTGGAGTAACAGCTGTTAGAAACGCTTGGTA
TGACTCAAAACAAGTGACGGATCACGTCGTTCAGGGCTATACAAAGCCTCTAAAAGCAAAGGGATGGGACAAAGCTCTTG
TTGAGTTCACCGTGGCTACATTAACGGATAACAATGGCTCAGAGAAGAAACCTCCATTGTCGAAAAGGTTACAAGAAATC
AAATGCCCTGTTCTGATTGTCACCGGAGATACGGACCGGATTGTGCCAGCATGGAACGCAGAGAGGCTGTCACGAGCCAT
CCCTGGATCGGTGTTCGAAGTGATTAAGAAATGTGGGCATCTTCCACAAGAGGAAAAGCCAGACGAGTTCATATCTGTTG
TTGCAAAGTTTCTAGGGGATGTTTTTGGAGGGTCACAACGAGAGCAACAAGTGGACTTGAAGTTCCAAGGCAGTGTGTCA
TAA