Details for Chinese cabbage Locus Brara.E02983

Position : A05 ( 5`- 25080852 .. 25082599 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02983

Protein [Map View]
MKIFHVPCLQDNYSYLIIDESTGDAAAVDPVEPEKVIQSAEHHHAKIKFVLTTHHHSDHAGGNEKMKQLVPGIKVYGGSL
DKVKGCTDAVDNGDTLSLGQNINILALHTPCHTKGHISYYVTGKDGETPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVT
LASLPKPTQVYCGHEYTVKNLEFALTVEPNNEKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRVNNPEIQEKLGCK
SPIDTLREIRNKKDQWRG*

DNA
ATGAAGATCTTCCACGTTCCCTGTCTACAAGACAACTACTCGTATCTGATAATCGATGAGAGCACCGGAGACGCGGCGGC
TGTGGATCCAGTTGAACCGGAGAAAGTGATTCAGTCGGCTGAGCATCACCACGCCAAGATCAAGTTCGTCCTCACCACGC
ATCACCACTCGGATCATGCTGGTGGCAACGAGAAGATGAAGCAGCTGGTACCTGGAATCAAAGTCTATGGAGGCTCTCTT
GATAAGGTCAAGGGATGCACTGATGCTGTCGATAATGGTGACACCTTGTCTTTGGGTCAAAATATTAACATATTAGCTCT
TCACACCCCTTGTCACACCAAGGGTCACATTAGTTACTATGTCACTGGCAAAGATGGAGAAACCCCAGCCGTGTTCACTG
GAGATACACTTTTCGTTGCTGGCTGTGGGAAGTTTTTCGAAGGGACAGCTGAACAGATGCATCAGTCTTTGTGTGTGACT
CTGGCTTCATTACCTAAACCGACCCAGGTTTACTGTGGCCACGAGTACACCGTGAAGAACTTGGAGTTTGCTTTAACTGT
GGAACCAAACAACGAGAAGATACAGCAGAAGCTATCATGGGCCCGTCAACAGCGCCAAGCGAACCTTCCCACAATCCCTT
CAACACTAGAGGAAGAGCTCGAAACAAACCCGTTTATGCGCGTTAATAATCCTGAGATACAGGAGAAACTTGGTTGCAAA
TCACCGATCGATACTCTCAGAGAAATCAGGAACAAGAAGGATCAGTGGAGGGGATAA