Details for Chinese cabbage Locus Brara.E02982

Position : A05 ( 5`- 25080013 .. 25080745 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02982

Protein [Map View]
MGKQPVKLKAVVYALSPFQQKIMTGLWKDLPEKIHHKVSENWISATLLVTPVLGTYWYAQQFQEQEKLEHRF*

DNA
ATGGGGAAGCAGCCTGTGAAGTTGAAGGCGGTGGTATACGCGCTATCGCCGTTTCAGCAGAAGATAATGACAGGACTTTG
GAAGGATCTCCCTGAGAAGATCCACCACAAGGTCTCTGAGAATTGGATCAGCGCCACTCTCCTCGTCACCCCGGTCCTCG
GAACCTACTGGTATGCTCAGCAATTCCAGGAACAGGAGAAACTAGAGCACAGGTTCTGA