Details for Chinese cabbage Locus Brara.E02979

Position : A05 ( 5`- 25068726 .. 25070059 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02979

Protein [Map View]
MDPYTETGSVNLDSSLWPHASKSLPELLTEICQKAQKMLKLIKDGQPESTDIFLTFYQSLGESYNHLNQELLNGFLNFDI
KPSSSDKNSVSFRSDSSPSLEFDLVSGVSYSSLKLNDEAEKKDQSAYMLADFFSDELRTALRDLEERNTLVGELESKLSD
SNDKIKTLERELDECHELLEVSEVEVSKLNEMLTEKADNGADLLLNTLRAELRSRDVQIEQMEEYLNQVCVKDTELLSDD
ESGTNKSVVEELKSRVEELENQVEKQSNVISEREEEKREAIRELCVSLDHYKSRYTELVISLSGNN*

DNA
ATGGATCCTTACACAGAAACTGGATCAGTGAATCTTGATTCATCCTTGTGGCCACATGCTTCTAAGTCATTACCAGAACT
CTTAACAGAGATATGTCAGAAAGCTCAAAAAATGCTCAAACTGATCAAAGATGGTCAACCTGAGTCAACAGATATTTTTC
TTACCTTTTATCAGTCTCTTGGTGAGTCTTACAATCATCTGAACCAAGAGCTCCTCAACGGCTTCCTCAATTTTGATATT
AAACCTTCATCTTCAGACAAAAACAGTGTCTCTTTTAGATCTGATAGCTCTCCTTCTCTGGAGTTTGATTTGGTGTCAGG
AGTCTCTTACTCATCTCTTAAGCTGAATGATGAGGCTGAGAAGAAGGACCAGTCTGCATATATGCTTGCTGATTTCTTCA
GTGACGAGCTTAGGACTGCACTGAGAGATCTAGAAGAGAGAAACACACTGGTGGGCGAGTTAGAGAGCAAGCTATCTGAT
TCAAACGACAAAATCAAGACTCTAGAACGCGAGCTCGATGAGTGCCATGAGCTTCTAGAGGTATCAGAAGTCGAGGTTTC
GAAACTGAATGAAATGTTGACCGAGAAAGCCGACAATGGTGCTGACTTGTTGTTAAATACCCTGAGAGCAGAGCTGAGGT
CGAGAGATGTTCAGATCGAGCAAATGGAGGAGTATTTGAACCAGGTGTGTGTCAAAGACACTGAGCTTCTGTCTGATGAT
GAGTCGGGAACCAACAAGAGTGTCGTGGAAGAATTGAAAAGTAGAGTTGAAGAGCTGGAGAATCAAGTGGAGAAGCAGAG
TAATGTGATATCCGAAAGAGAGGAAGAGAAAAGGGAAGCTATAAGAGAGCTCTGTGTCTCTCTTGATCATTACAAGAGCA
GATACACTGAACTTGTAATATCACTTTCAGGCAATAACTAA