Details for Chinese cabbage Locus Brara.E02977

Position : A05 ( 5`- 25055960 .. 25057529 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02977

Protein [Map View]
MAIRSGLSRRTLSSLKESSSKLLGLRGIQTFTLPDLPYDYSALEPAISGEIMQIHHQKHHQTYVTNYNNALEQLDQAVNK
GDASTVVKLHSAIKFNGGGHVNHSIFWKNLAPVNQGGGEPPKGALGGAIDTHFGSLEGLVKKMSAEGAALQGSGWVWLGL
DKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPDYLKNVWKVINWKYASEVYESECK*

DNA
ATGGCGATTCGTTCTGGATTGAGCAGAAGAACCCTATCCAGCCTAAAGGAGTCGTCTTCTAAGCTTCTGGGACTCAGAGG
AATCCAGACCTTCACGCTTCCTGATCTCCCTTATGATTACAGCGCGCTGGAGCCGGCGATTAGCGGCGAGATTATGCAGA
TTCACCACCAGAAGCATCACCAGACTTACGTCACTAATTACAACAATGCCCTCGAGCAGCTTGATCAGGCCGTCAACAAG
GGAGACGCTTCCACTGTCGTCAAGCTGCATAGCGCCATCAAGTTCAACGGCGGAGGTCATGTGAACCATTCGATTTTCTG
GAAGAATCTTGCTCCTGTCAATCAAGGTGGTGGAGAGCCGCCAAAGGGAGCTCTAGGTGGAGCTATTGACACTCACTTTG
GCTCTCTTGAAGGTTTGGTGAAGAAGATGAGTGCTGAAGGTGCTGCTCTTCAAGGTTCAGGATGGGTGTGGCTCGGTTTA
GACAAAGAACTTAAGAAGCTTGTGGTTGACACAACCGCCAATCAGGATCCACTTGTGACAAAAGGAGGAAGCTTGGTTCC
TCTGGTGGGTATTGATGTTTGGGAGCATGCCTACTACTTGCAGTACAAGAATGTGAGGCCGGATTATCTGAAGAACGTGT
GGAAAGTTATCAACTGGAAATACGCTAGCGAAGTTTATGAGAGTGAATGCAAGTGA