Details for Chinese cabbage Locus Brara.E02974

Position : A05 ( 5`- 25049024 .. 25051285 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02974

Protein [Map View]
MEQELPSSTRTKPTLPNRLNTYVGSSRVGKRFKLAERNSTFTTELRAGTATFLTMAYILAVNASILSDSGGTCSVSDCVP
LCSNPTIPPSQCTGPVLRLIQPDVTCKFDPVNPGYASCVEGIRKDLIVATVAASLIGCVIMGLMANLPLALAPGMGTNAY
FAYTVVGFHGSGSISYQTALAAVFIEGLIFLFISAIGFRAKLAKLVPKPVRISSSAGIGLFLAFIGLQNNQGLGLVGYSP
STLVTLAACPTTSRASLAPVITSANGTVTLIPGGAVSGDIMCLHGRMESPTFWLGIVGFVIIAYCLVKNVKGAMIYGIVF
VTAVSWFRNTEVTAFPNTPAGDAAHEYFKKVVDVHVIKHTAGALSFSGISKGHFWEALVTFLYVDILDTTGTLYSMARFA
GFVDERGDFAGQYFAFMSDASAIVIGSLLGTSPVTVFIESSTGIREGGRTGLTAITVAVYFFLAMFFTPLLASIPAWAVG
PPLILVGVMMMKSVTEIEWGDMREAIPAFVTMIMMPLTYSVAYGLIGGIGTYVVLHLWDWGEEGMVRLGFLKRKVEEEDN
NSNGVVKVNETHTSV*

DNA
ATGGAGCAAGAACTACCTTCTAGTACTAGAACCAAGCCCACGCTACCAAACCGACTCAACACTTACGTCGGTTCAAGCCG
AGTTGGCAAACGGTTCAAACTCGCCGAACGGAATTCAACTTTCACGACGGAGCTCCGCGCCGGCACGGCGACTTTCCTCA
CCATGGCTTACATACTCGCCGTGAACGCCTCCATCTTATCTGACTCCGGCGGCACATGCTCTGTCTCCGACTGTGTTCCC
CTCTGCTCAAACCCAACGATCCCACCTTCCCAGTGTACCGGACCGGTTCTCCGACTGATCCAACCGGACGTAACCTGTAA
ATTCGATCCGGTTAACCCCGGATACGCATCGTGCGTGGAAGGAATCCGAAAGGATCTAATCGTCGCCACCGTGGCCGCGT
CTCTGATCGGGTGCGTGATCATGGGGCTGATGGCGAATCTCCCTCTAGCTCTAGCTCCGGGGATGGGAACCAACGCGTAC
TTCGCTTACACCGTCGTCGGTTTCCACGGATCCGGTTCAATCTCGTACCAAACCGCTCTCGCCGCGGTTTTCATCGAAGG
GTTAATATTCCTCTTCATCTCCGCCATAGGCTTCAGAGCGAAGCTAGCGAAACTCGTCCCTAAACCGGTCCGAATCAGCT
CCTCCGCCGGAATCGGACTCTTCCTCGCCTTCATCGGTTTACAGAACAATCAAGGACTCGGTTTAGTCGGTTACAGCCCT
TCCACTCTCGTCACTCTCGCCGCGTGTCCAACCACCTCACGAGCTTCTCTAGCTCCCGTTATAACGTCCGCTAACGGAAC
CGTTACTTTGATCCCCGGAGGAGCCGTTTCGGGAGATATCATGTGCCTCCACGGACGCATGGAGAGTCCAACCTTCTGGC
TAGGCATCGTCGGGTTCGTGATCATCGCCTACTGTCTGGTGAAGAACGTGAAAGGAGCGATGATCTACGGGATCGTCTTC
GTAACGGCCGTTTCGTGGTTCCGTAACACCGAGGTAACGGCGTTTCCCAACACCCCCGCGGGAGACGCGGCTCACGAGTA
TTTCAAAAAGGTCGTTGACGTCCACGTCATCAAACACACGGCGGGAGCGTTGAGCTTCTCGGGGATAAGCAAAGGGCATT
TCTGGGAAGCGTTAGTGACTTTCCTCTACGTGGACATTTTGGACACGACGGGGACGCTCTACTCCATGGCGAGGTTCGCC
GGATTCGTCGACGAGAGGGGAGACTTCGCGGGGCAGTACTTCGCGTTCATGTCCGACGCGTCGGCGATCGTGATCGGATC
GCTTTTAGGAACGTCCCCCGTGACGGTGTTTATAGAGTCCTCGACGGGGATACGGGAGGGGGGGAGGACGGGGCTGACGG
CGATCACGGTGGCGGTTTATTTCTTCCTGGCGATGTTCTTCACGCCGCTGCTGGCTTCGATTCCGGCGTGGGCGGTCGGG
CCGCCGTTGATACTGGTGGGGGTGATGATGATGAAGTCGGTGACGGAGATAGAGTGGGGGGATATGAGGGAGGCGATTCC
GGCGTTCGTGACGATGATTATGATGCCGTTGACGTACTCGGTGGCGTACGGGTTGATCGGAGGGATAGGGACGTATGTGG
TGTTGCATCTGTGGGATTGGGGAGAGGAAGGGATGGTGAGATTGGGGTTTTTGAAAAGGAAAGTTGAAGAAGAGGATAAC
AACAGCAATGGAGTTGTGAAAGTTAACGAGACTCATACGTCCGTTTAG